Etiketterpersonlig-utvecklingparadigmskiftenhealingmetamorfos
Läst 3425 ggr
JRSN
2020-04-01, 20:41

Bakgrunden till 'Coronapandemin'

Följande videor är för de med ett öppet sinne och som vågar se utanför etablerade livsramar. Är Coronaepidemin en olycklig slump eller ligger det något mer uträknat bakom det hela? Används i själva verket omvälvande händelser i syfte att skapa en ursäkt till att mer övergripande förändra samhället i grund? Döm själva! 🤔

Prof. Walter Veith - Watch until the end

Extended Lockdowns, A Form of Mass Torture

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

http://dipbt.bundestag.de/dip21/btd/17/120/1712051.pdf
  • Redigerat 2020-12-28, 21:05 av JRSN
Herveaux
2020-04-01, 21:07
#1

Tack för tipsen!


// Harley 🏳️‍🌈⚧️
Sajtvärd Star Stable Medarbetare SupportRidsport, Film, Hamster

JRSN
2020-04-02, 16:45
#2

Investigativer Journalist Billy Six deckt Corona-Lüge in Charité Hospital in Berlin

Videon ovan är inget mindre än chockerande. Den avslöjar omfattande fusk och bedrägerier med statistik angående påstått coronasmittade. Någon reell pandemi existerar inte, alla rapporter bygger på manipulerade data och sporadiska tester utan godtagbara och verifierade mätvärden. Något annat än en pandemi pågår!

Videon är på tyska och dessvärre ofullständigt textad till engelska. Trots detta är innehållet mycket informativt och avslöjar en rad mediala lögner. Den som behärskar tyska språket kan förstås tillgodogöra sig videon ännu bättre.

Videon sägs upprepat 'försvinna' från YouTube men är fortfarande kvar på 'Vimeo'.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-03, 08:08
#3

Fler "kaotiska" scener med människor som köar vid sjukhus och testplatser för Coronaviruset - INTE! Inga köer, inga människor, tomt i sjukhusen. Mediernas bild av 'pandemin' står i total kontrast till verkligheten. Vakna upp och se sanningen!

More good news? Citizen reporters go & do what the media won't!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-03, 08:27
#4

Aj, aj! Utrustning för Coronatestning i England har befunnits kontamierad med, rätt gissat; det virus som orsakar Covid-19. Vilken otur att det blev så, eller var det i själva verket - meningen! 😛

Coronavirus testing delayed after kits found to be contaminated by Covid-19

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-04, 05:49
#5

Följande video stämplas automatiskt på Facebook såsom 'konspirationsteori'. Är en sådan censur ens laglig? Uppenbarligen i Facebook's kontrollerade värld. Detta kan bara betyda en av två saker: Antingen är videon verkligen så konspiratorisk att den riskerar folks liv och hälsa. Alternativt innehåller videon värdefull information, men att den samtidigt utgör ett hot mot myndighet, företag eller etablissemang.

Videon handlar om att tester av Covid-19 vilar på mycket svajande vetenskaplig grund. Jag tycker själv att videon är såväl balanserad som saklig. Döm själva.

Is COVID-19 Even Real? 

Tillägg 20200507: Videon raderad från YouTube men har sen dess lagts in på BitChute. Länken är uppdaterad!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

wildfire
2020-04-04, 09:02
#6

Har gått i dom här tankarna och det är skrämmande men samtidigt vill man inte tro att vi skulle bli så bedragna men men vad vet man. En sak det här fört med sig är att jag helt tar avstånd frånl all politik så som jag gjort i alla år förr men ramlade in en protestperiod på den men det tog stopp helt tack och lov  för det handlar bara om makt och att storebror ska ha kontroll över oss.

Vi är på god väg mot ett kontrollsamhälle, något sker nu världen över som vi inte kan styra över och man kan undra vart tänker det här sluta.

JRSN
2020-04-04, 10:09
#7

#6 Ja, en obehaglig utveckling. Jag har inte röstat på ett antal år. En kanske löjlig protest men i alla fall en markering mot toppstyret i samhället. 🌺

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

wildfire
2020-04-05, 17:25
#8

Vi har mer att vänta 😕det är bara början det här.

https://www.svt.se/nyheter/utrikes/analys-storebror-skyddar-dig

Ingenting stoppar oss nu 😡

JRSN
2020-04-06, 14:03
#9

#8 Det jag blir beklämd över är att så få verkar reagera på att vi med raketfart är på väg in i ett totalitärt samhälle. Den här krisen handlar inte om virus utan om en starkt upptrappad övervakning. Ytterst få hissar varningsflagg. Redan 2017 skrev jag ett blogginlägg med titeln: Sverige-Nya DDR? Vi tycks redan vara där nu!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-07, 11:54
#10

En ny video med David Icke. Om inte detta budskap blir en väckarklocka till folk i allmänhet, då vet jag inte. Videon går igenom specifik information om hur 'RT-PCR-test' går till i praktiken och hur utfallet tolkas (manipuleras) att visa utslag för viruset Covid-19, ett virus som aldrig har isolerats och som därför - inte existerar!

DAVID ICKE - THE CORONAVIRUS CONSPIRACY

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Carmarino
2020-04-07, 16:21
#11

För min del så tror jag inte ett dugg på David Icke. Har hört alldeles för mycket om honom för att lita på ett ord av vad han säger.


¡ɹnʇɐuƃıs ɯos uǝp ɐɥ ɥɔo uǝʇxǝʇ ɹäɥ uǝp ɐɹǝıdoʞ ʇʇɐ ɹöɟ ɹɐlʞ åsʞɔo uɐʇn ʇɹɐɯs ɐɹɐq ǝʇuı np ɹä ɹäɥ ʇǝp ɐsä1 np uɐʞ

wildfire
2020-04-07, 17:21
#12

#9 Visst är vi på väg till ett totalitärt samhälle, det har vart på gång länge och jag minns hur jag redan på 90-talet varnade för det här när jag vägrade att ta hem en dator genom jobbet det var stopp och vad gör jag idag jo jag sitter och skriver på en sån där sak i alla  fall 😕 jag som alla åkte dit men jag har så lite teknik som man bara kan ha och vet du folk tror inte på mig när jag säger att jag har inte kanaler på tv, jag har inte netflixx eller vad det heter eller en padda med bankid och sånt min mobil är stenålder med endast sms  men  folk tror jag skämtar eller rent av ljuger men jag ställer helt enkelt inte upp på det  men jag har ett gammalt modem hos telia och när det blir för gammalt för att använda då säger jag upp internet så enkelt är det men jag kör på så länge det håller sen blir det bye bye 😎

#11 Jag får hålla med dig där för jag är inte mycket för David Icke tvärtom han göder sig helt på det kommersiella livet och det faller inte mig i smaken alls så den mannen tar jag stort avstånd från. Man måste vara sin egen utan en Guru som styr sig och bilda sin egen uppfattning vilket Icke inte bidrar till för den mannen är farlig med sitt sätt att göda i såna här tider.

JRSN
2020-04-07, 17:45
#13

#11 #12 David Icke eller inte, det kan man tvista om. Men det jag stöder in i kaklet är rätten till det fria ordet. Jag blev lite illa berörd härom dagen när jag skulle lägga in en, som jag tyckte, intressant video i Facebook och sajten stämplade videon såsom en 'konspirationsvideo'. Det blev alltså ett 'snett band' rakt över videon med en varningstext. Med andra ord så censurerar Facebook människors inlägg helt oblygt.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

wildfire
2020-04-07, 17:57
#14

Där har du varningens tecken på David Icke han är inte god , jag vill fråga är han din Guru eller tänker du själv ?

JRSN
2020-04-07, 22:40
#15

#14 Just den videon var inte med David Icke, det var videon ovan; 'Is COVID-19 Even Real?'. Självklart är han inte min guru, jag tänker i mina egna banor. Det finns idéer jag inte gillar hos Icke, andra saker tycker jag han beskriver väldigt bra. Allting är inte svart eller vitt, man kan ta intryck av andra i fråga om vissa saker, andra inte. Sen handlar det ju inte om David Icke som person, utan om det han talar om. Har du faktiskt sett hans senaste video? Den var rätt lång, över två timmar.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-07, 23:47
#16

Precis i början av videon gör David Icke ett citat av upptäckaren, Nobelpristagaren Kary Mullis, som upptäckte metoden PCR (wiki) eller RT-PCR (wiki) som den också kallas. Reverse Transcript Polymerase Chain Reaction.

Kary Mullis sa att PCR får aldrig användas för att fastställa virussjukdom. Mullis sa att PCR kan inte användas för att sätta sjukdomsdiagnos av flera orsaker. Dels kan ytterst små mängder virus finnas på huden, i luften, i blodet, saliv, snor, så små mängder virus att det inte är sjukdomsskapande, dels kan fragment av förstörda virus finnas i saliv, på hud, i blod, svett etc, hos någon som redan är immun mot viruset.

Orsaken är att PCR är extremt bra på att duplicera DNA, RNA och pyttesmå fragment av DNA/RNA, från virus, andra bakterier och parasiter som mycket väl redan kan vara döda eller inaktiva.

Du får alla möjliga falska positiva utslag på coronavirus av PCR. Fragment från andra stammer corona du redan är immun mot från förr-förra årets snuva etc.

Vad används PCR idag till över hela världen?

Diagnos av "COVID-19"…

Finns SARS-CoV-2 alls? Vågar man ställa den frågan?

Ja, ja… Det finns dom som inte vill höra på David Icke enbart för att det är David Icke. Blundar med öronen och går på angrepp mot personer som faktiskt har lyssnat på innehållet av det Icke säger…

Om upptäckaren av PCR, Nobelpristagaren Mullis sagt att PCR/RT-PCR inte ska användas för diagnos, varför används i så fall PCR i tester för att detektera smitta med SARS-CoV-2, den sk "COVID-19"?

Därför att det är en agenda bakom.

Bilderberggruppen.

Även mycket intressant i videon i #2.

Läkaren i Kiel, Klaus Köhnlein, invärtes medicin och arbetande på sjukdomssmittoklinik, redogör för orsaken till höga dödstalen i Italien och Spanien, är italienska och spanska läkares metoder för att behandla "COVID-19", låtsassjukdomen.

Samtidigt rasar årets influensa i det tysta som redan dödat 300 000 personer i år, men som det inte nämns något om i media.

"COVID-19" i Italien och Spanien behandlas med höga doser kortison och liknande inflammationshämmande ämnen. Målsättningen är att häva inflammationen i lungorna så att patienterna inte kvävs, vilket lyckats initialt för kortison suger ut all vätska ur organ och man får en vätskedrivande effekt och inflammationen i lungorna avtar.

Kortvarigt blir "COVID-19"-patienterna bättre och verkar kunna andas obehindrat…

Men…

Kortison dödar också lymfocyterna, en viss typ av vita blodkroppar, som bekämpar virus och bakterier, inklusive coronavirus.

I synnerhet har det rapporterats att många patienter påstått med SARS-CoV-2, påstått sjuka i "COVID-19", har extremt låga halter av T-celler. Vad är T-celler? T-celler är lymfocyter. Låga halter av T-celler trots att patienten är sjuk, betyder att något dödar T-cellerna. Vad är det som dödar dom sjukdomsbekämpande T-cellerna (en sorts lymfocyter)?

Kortison dödar T-cellerna.

Halterna av T-celler hos patienter som dog som flugor i Wuhan, Kina, var extremt låga. Kinesernas T-celler dog i massvis även hos relativt unga patienter.

Kortison.

Därför har Italien och Spanien höga dödstal jämfört med Norge och Tyskland, där man är mer medveten om farorna med kortison. Användandet av kortison mot "COVID-19" är så frikostig i Italien att 38 italienska läkare som jobbat inom smittskyddet dött i "COVID-19". Troligen för att dom italienska läkarna själva trott att kortison hjäper mot "COVID-19". Men istället har dom italienska läkarna tagit död på sej själva.

Äldre patienter som har svaga immunsystem och svårt att bilda T-celler, dör efter några dagars behandling med starka doser kortison, trots att dom får allt lättare att andas i början. När T-cellerna är döda går det sedan åt skogen. Alla möjliga bakterier och virus får därefter fritt spelrum att slå ut organ, orsaka blodförgiftning och hjärtstopp.

Fejksjukdomen "COVID-19".

Diagnos med PCR/RT-PCR….

JRSN
2020-04-08, 05:55
#17

#16 Tack för hjälp att reda ut de rejält svåra tekniska, medicinska och genetiska begreppen kring Covid-19! Det är givetvis svårt för flertalet att ens ta in att en sådan ondska kan få utrymme att verka på så hög nivå. Läkemedelsbolagen har av allt att döma rekommenderat 'behandlingen' mot Covid-19. Läkare, politiker och olika vårdinstanser följer blint råden utan att ifrågasätta eller göra en oberoende granskning och utvärdering om metoden verkligen är medicinskt försvarbar.

'Agendan', om man ens vågar använda det ordet, är så långt gången och går så högt upp i hierarkin att gemene man givetvis avfärdar den som vanliga 'konspirationer'. Det går liksom inte att greppa med sunt förnuft att sådana planer kan existera och vara genomförbara. Just däri ligger faran med agendan. Makthavarna som agerar bakom kulisserna gömmer sig bakom den frapperande fräckheten och oblygheten. Självklart hjälper också ett närmast totalt monopol över storbanker och kapital.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-09, 08:07
#18

MSB-chefen Dan Eliasson jobbar på högtryck för att uppfylla Bilderberggruppens agenda. Sveriges Radio, 2020-04-08

"En tjänsteman på MSB Myndigheten för samhällsskydd och beredskap säger till Dagens Nyheter att olika företags erbjudanden om hjälp i att bekämpa coronapandemin blir liggande på myndigheten. Tjänstemannen som vill vara anonym säger att det finns massor av bra initiativ, men de hamnar i ett svart hål och att MSB blivit en bromskloss som inte låter behov och resurser mötas."

Dan Eliasson, fd Rikspolischef. MSB - ett svart hål i marken.

Genom att skylla på "ineffektivitet" och "inkompetens" kan myndigheterna uppfylla Illuminatifamiljernas krav på att öka rädslorna hos befolkningen. När inte dom egna myndigheterna fungerar, kommer folket kräva hårdare åtgärder och undantagslagar kan börja införas av Löfvenregeringen.

problem-reaction-solution

Polisstaten Danmark har redan inriktat medborgarna att anmäla anonymt via internet, misstänka "coronasmittade", personer som trotsar utegångsförbud och samlingar. Sveriges Radio, 2020-03-24

Polischeferna säkerställer själva att dom inte följer "skyddsrekommendationerna" med målsättning att skapa panik hos allmänheten, helt i linje med Löfvenregeringens åtlydnad av bilderbergarna. Sveriges Radio, 2020-04-05

Massövervakningen som Snowden avslöjade ökar och Telia lämnar glatt ut mobildata till centrala Illuminatiorganisationer inom EU, som skickar informationen vidare till internationella säkerhetstjänster i Ryssland, USA och Kina. Sveriges Radio

Officiellt sett för att "bekämpa coronaviruset".

wildfire
2020-04-09, 17:10
#19

Jag är helt enig med er i tråden att det finns dolda agendor här sen att jag personligen har problem med David Icke det har jag haft i så många år och varenda varningsklocka ringer i mig så fort jag ser eller hör om honom.

En väninna till mig brukar skicka länkar till honom och det blir inte alltid helt lätt för jag får liksom försöka lirka och hitta på nåt annat att prata om men så envisas hon och till slut var jag tvungen att säga den mannen han är inte god.

Nu har även han saker som kan låta bra  men hela den karlen får mig att skaka hela vägen in i anden och jag har en tillit till min guide och min egen känsla där att honom ska jag avhålla mig från.

Däremot det här Covid-19 det köper jag inte rakt av. Jag tror absolut att det är ett planterat virus för att få makt men att en sjukdom florerar som gör människor sjuka genom att vi inte är immun det ställer jag mig bakom men  aldrig att alla indragna personer världen över är med om en konspiration som skulle skada mänskligheten på det här viset.

Jag ser också att ögon öppnas för det ifrågasätts hur rätt är det här egentligen. En sjukdom driver runt som vi inte är immun mot, än är jag inte drabbad och jag ifrågasätter men om jag blir drabbad så kanske säger jag något helt annat för jag är en av alla dom som är i riskzonen för Corona och stryka med.

Om jag stryker med så skulle jag önska att jag kunde komma in hit och berätta för er, att jag på något andligt vis som min guide gör prata och säga hur det är för det är något som jag önskar jag skulle kunna dela med mig till mänskligheten av  men jag vet att när jag går över så är jag klar med jordelivet som så många andra och behöver inte återvända hit för alla går vi över en dag och då har ingen av oss behovet att berätta eller fundera som vi gör  för då är vi fria i anden och hemma i ljuset och jordens våndor dom ter sig små i jämförelse med den frihet och glädje som vi får i hemmet  ❤️

Carmarino
2020-04-09, 17:30
#20

#19 Får precis samma känsla när det gäller David Icke. Skönt att veta att jag inte är ensam om det. 🙂


¡ɹnʇɐuƃıs ɯos uǝp ɐɥ ɥɔo uǝʇxǝʇ ɹäɥ uǝp ɐɹǝıdoʞ ʇʇɐ ɹöɟ ɹɐlʞ åsʞɔo uɐʇn ʇɹɐɯs ɐɹɐq ǝʇuı np ɹä ɹäɥ ʇǝp ɐsä1 np uɐʞ

JRSN
2020-04-09, 20:15
#21

En invändning som jag alltid haft om David Icke är att han envisas med att tala om 'reptiler' såsom roten till allt ont. Jag tror nämligen att han har förväxlat dem, eller blivit vilseledd. Min tanke är att det är demonerna som (osedda) driver agendor i världen. Reptilerna däremot, är varken goda eller onda. De är sannolikt de som på genetisk väg skapade människorna, och att vi därför är släkt med dem. I övrigt ser jag nog att Icke har många bra analyser, även om de kan vara svåra att smälta.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-09, 20:38
#22

Reptilians = engelskans; reptil-liknanden, dvs liknar en reptil.

Det är inte samma sak som en ödla, orm, sköldpadda eller annan reptil. Reptilians är ett utseende, inte en djurgrupp. Det reptil-liknande utseendet, dvs reptilian, kan vara ett bedrägligt utseende och reptilians kan visa sej vara något helt annat.

Icke har dom senaste åren använt beteckningen Archons nästan lika mycket som reptilian, då Archon inte är utseendebeskrivande och har sitt ursprung i gamla gnostiska texter åtminstone århundranden före jesus påstådda existens.

I vissa sammanhang blandas begreppen Archons, djinn och "demoner" samt grå "rymdvarelser". Archons vare ett slags "härskare" på jorden en tid och ordet anarki (eng. anarchy) betyder uppror mot Archons.

Exakt vad Archons är, det är en gåta. Fysikern Jacques Vallée är t o m inne på tanken att varelserna det rör sej om egentligen är människoliknande varelser, då det finns flera möten med sk väldigt vackra människor som visat sej ha onda avsikter och minst sagt övernaturliga förmågor.

Även historikern Richard Dolan har intervjuat personer som mött vackra människor, som liknat skandinaviska fotomodeller, och som haft tankekontroll och andra övernaturliga förmågor mot den person som hamnat under kontroll.

Vi vet som sagt inte vad dessa varelser är eller hur dom faktiskt ser ut, om dom ens har en fysisk form.

JRSN
2020-04-09, 21:19
#23

#22 Tänkvärt. Det som, åtminstone jag, 'ser' vid en Demonutdrivning är en slags djävulsliknande figur, finlemmad, seg och stark. Sen om demonerna gillar att anta den skepnaden är osäkert. Man kan ana likheter med reptiloida väsen. I andra fall är demonerna grönaktiga, böljande men även där med vissa mänskliga attribut. Kanske har demonerna förmågan att ändra form men att de är oformliga i grunden. Det kan också vara att andra väsensformer finns med i bilden, som vi inte vet så mycket om.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-10, 16:31
#24

Låt oss börja med antagandet att det bara finns två grupper av intelligenta varelser på jorden. Människor som syns tydligt i den fysiska världen och vättar som kan hålla sej osynliga i den fysiska världen.

Människor och vättar - (eller gör valfri egen definition).

Som historieprofessor David Jacobs har sagt. Om det på jorden finns en intelligent grupp av varelser till, förutom människan, som kommit utifrån, t ex extradimensionellt. Så finns det inte en grupp till…

Bara en grupp till är orimligt.

Det finns snarast i så fall ett stort antal olika grupper av osynliga (mindre synliga i alla fall) intelligenta varelser som verkar i det tysta, troligen med egna agendor av olika slag och troligen även med inbördes konflikter.

Det kan finnas 100-tals eller 1000-tals grupper av intelligenta varelser, som av olika skäl, på olika sätt, är på, i eller i närheten av jorden. Så frågan är vilken roll vi spelar? Är vi här för att "skördas" som språkdocent Karla Turner misstänkte?

Antagandet i början av detta inlägg kan därför ses som högst tveksamt. Det finns troligen fler än bara två grupper.

Någon eller några av dessa grupper av osynliga varelser kan vara dominerande på jorden och kontrollerar människorna i Illuminatifamiljerna, världens mänskliga makthavare = djupa staten, skuggregeringen, som i sin tur kontrollerar underorganisationerna Bilderberggruppen, CIA, FN, FED, IMF, WB, CFR etc. Det är i alla fall vad Icke tror sej ha bevisat. Han kallar den styrande/dominerande gruppen Archons eller "reptilians" och varelserna har varit i kontroll av mänskligheten i 1000-tals år med långtgående agendor.

En av agendorna just nu är att sprida tron på sjukdomen "COVID-19". Visst, det kanske finns en sjukdom, folk verkar ju dö, men är sjukdomen orsakad av SARS-CoV-19 eller orsakas sjukdomen av 3G/4G/5G + chemtrails som inverkar menligt på folks lungor och orsakar sjukdomstillståndet ARDS? Enligt media dör ju unga människor också och dör ibland väldigt plötsligt av fejksjukdomen "COVID-19".

Det kanske ska tilläggas att det kan finnas (leta på Richard Dolan) ett dolt mellanskikt mellan Archons och Illuminati, det sk Breakaway Civilization, en grupp av människor som ligger 50 - 250 år före oss teknologiskt och som ser sej som överlägsna gentemot den övriga mänskligheten.

Dessutom misstänker Icke att det finns en grupp varelser till, ovanför Archons, "genomskinliga varelser", som inte kan ta form i fysiska världen och vi ser dom nästan aldrig annat än i andevärlden. Dom genomskinliga kan kontrollera och styra Archons eller reptilians. Existens av dom genomskinliga har rapporterats av enstaka shamaner som gjort anderesor utanför den fysiska världen.

JRSN
2020-04-10, 22:01
#25

#24 Det var mycket att ta in, intressant förstås. Vad gäller osynliga väsen så är jag 'medveten' om flera olika dimensioner vilka kan ha väsen som för oss inte kan urskiljas. Jag trodde dock att dessa dimensioner var oberoende av vår dimension, och att livsöden inte blandades. Så är kanske inte fallet trots allt. Frågan är vad de kan ha för intresse av jordiska angelägenheter? I fråga om Covid-19 och tillståndet ARDS så misstänker jag starkt att den aktuella 'blandningen' av chemtrails orsakar sjukdomen. Någonting tycks bl.a. få kroppen att bli starkt försurad vilket påverkar njurar att inte utsöndra vätska ur kroppen. I svåra fall kan då vätska även ansamlas i lungorna och få patienter att drabbas av akut syrebrist. När 5G är fullt utvecklad kan detta möjligen orsaka liknande symtom. Kanske finns även en synkronicering mellan 5G och chemtrails. Exakt hur det kan gå till är något osäkert.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-10, 23:39
#26

Icke har berättat om detta med reptilians/Illuminati i mer än 20 år.

Dana Ashlie i #3 noterade att syre O2 - kan påverkas av 5G, frekvensområdet tror jag var 40 - 60 GHz. Vilket i sin tur kan påverka syreupptagningen i kroppen. I Wuhan och i norra Italien finns det flera områden med 5G eller 4G nära 5G-området. Även andra städer i Europa har 5G-försök.

Afrika och Indien har däremot mera sparsamt med 5G och inte alls lika stora problem med fejksjukdomen "COVID-19".

wildfire
2020-04-11, 17:15
#27

När jag skev inlägget #19 väntade jag på svar, jag är coronasmittad och visst är det en verklig sjukdom men sen hur den uppkommit är en annan fråga. Allt gick så snabbt och bra mår man så klart inte men jag är hemma i karantän och att vara hemma känns så himla bra och jag hoppas innerligt slippa läggas in men jag får se vart det tar vägen.

Läste att man bränt en massa 5G master men frågan är kommer det verkligen därifrån, sunda är dom inte och forskare har varnat men att dom skulle kunna skapa ett sånt här virus verkar för mig ganska så ofattbart men nånstans har viruset börjat och naturligt är det inte nej nej något är riktigt galet med det här 😕

Huygens
2020-04-11, 17:53
#28

#27 Visst, visst kan det vara ett coronavirus du fått. Också vanliga bakterier som vi har på oss kan vara farliga om man har extrem otur och även unga människor kan drabbas av blodförgiftning.

Samtidigt är årets influensa svårare än normalt, 300 000 har dött av influensan i år, men det nämns inte i media. Problemet med påståendena om SARS-CoV-2 är också att ingen riktigt lyckats bevisa dess existens. Det kanske är som AIDS, det finns inte.

Var är bevisen?

Som nämnts tidigare, Nobelpristagaren Kary Mullis säger att PCR, som används för att sätta diagnosen "COVID-19", PCR sa han ska aldrig användas för att ge sjukdomsdiagnos, av flera ovan nämnda orsaker.

Så om du har fått diagnos med PCR/RT-PCR och Nobelpristagaren, professor Kary Mullis, som upptäckte PCR, säger att PCR aldrig ska användas för sjukdomsdiagnos…

Hur vet du då att du har "COVID-19"?

wildfire
2020-04-11, 18:18
#29

Visst, visst kan det vara ett coronavirus du fått. Också vanliga bakterier som vi har på oss kan vara farliga om man har extrem otur och även unga människor kan drabbas av blodförgiftning.

Samtidigt är årets influensa svårare än normalt, 300 000 har dött av influensan i år, men det nämns inte i media. Problemet med påståendena om SARS-CoV-2 är också att ingen riktigt lyckats bevisa dess existens. Det kanske är som AIDS, det finns inte.

Var är bevisen?

Bevisen sitter i det jag just nu genomlider , där har jag mina bevis för att det är ett aktuellt virus som smittar som bara satan uttryckligen sagt och jag är aldrig förkyld har inte varit på 18 år om jag har räknat rätt.

Det här är inga vanliga bakterier  , det är inte en vanlig förkylning eller flunsa som vi är vana den är på riktigt och jag är där men jag hoppas innerligt att du Huugens ställer om för här har du en livs levande människa som drabbats så nu får du tänka om för jag är sjuk i corona och det kan du inte bortse från det bevisar mina prover.

JRSN
2020-04-11, 21:46
#30

#29 Corona eller inte, ingen önskar förstås att du skall vara sjuk och bli dålig. Vi får hoppas att sjukdomen, vilken den än är, får ett kort och milt förlopp. Några råd törs man ju inte ge i dessa tider men sköt om dig så gott du förmår och krya på dig! 🌺🌺🌻

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-11, 23:39
#31

#29 Hur genomfördes COVID-19-testet på dej? Hur gick vårdpersonalen till väga för att testa dej för coronavirus?

JRSN
2020-04-12, 19:02
#32

Fick ett tips på en intervju med sanningssägaren Ole Dammegård som bland annat tar upp sambandet 5G och 'Coronaviruset'. Ole har själv forskat om maktelitens metoder och han beskriver utförligt agendorna som de följer.

Samband 5G och Virus? NWO på steroider

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-12, 19:16
#33

Det finns ett annat samband som jag har funderat på. Som bekant är koldioxiden utnämnd till klimatets fiende nummer ett, trots att ämnet är livsviktigt för att all växtlighet skall kunna frodas och utvecklas. Så vad händer nu om halterna av CO2 sjunker drastiskt på jorden? Växtligheten minskar förstås och därmed produktionen av syre, som ju växterna utsöndrar. 

Varför rekommenderar EU att just granträd planteras vid skogsodling? Kan det vara så att granar försurar och ger ett förhållandevis litet bidrag av syre? Det är till och med så att maskiner som absorberar koldioxid byggs. Försöker man med andra ord skapa en artificiell syrebrist på jorden, en syrebrist som sedan orsakar sjukdom i lungor, och som sedan skylls på - Covid-19. 

Lägg därtill utsläpp av farliga ämnen via 'Chemtrails', ämnen som ytterligare bidrar till att människor får problem med andningen. Se där ett antal starka indicier.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-15, 12:56
#34

Att myndigheter och potentater av olika slag ofta ljuger, det känner vi till. Men det är sällan vi får det bekräftat rakt på sak. Begreppet 'Omvänt tal' (Reversed Speech) innebär att vårt undermedvetna sinne faktiskt kan tala. Men talet är baklänges och i korta koncisa meningar. En intressant sak är att det undermedvetna är oförmöget att ljuga. Hör vad vissa uppsatta personers undermedvetna säger om Coronakrisen:

Reverse Speech of Dr. Anthony Fauci on the COVID-19

The Queen - Special Address during Pandemic

Reverse Speech of CNN Anchor Chris Cuomo On His COVID-19 Coronavirus

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

skina
2020-04-15, 15:27
#35

Jag tror att det är fullt naturligt att sjukdom uppstår när en art blir för många, som rävskabb ungefär. Titta på kina, Indien osv.. Phu, vad mkt folk och trångt och smutsigt på många ställen.

Jag läste någonstans i detta forum att demoner numera sprids via internet.. Kanske är de såhär de sprids, genom sådana här mörka tankar som drar ner folkets positiv energi och skapar oro och rädsla?  

Hmm… En tanke iaf..

JRSN
2020-04-15, 18:45
#36

#35 Helt rätt, demoner sprids och frodas genom mörka tankar, oro och rädsla. Det är en energi som gynnar denna 'ras' och blir det bränsle genom vilket de lever och förökar sig. Ju mer kaotisk och krigisk världen är, desto starkare blir demonerna.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

wildfire
2020-04-16, 05:51
#37

#35 Tragiskt nog är det så att demoner tar sig in vägen via internet och här undrar jag varför har man nätet och göder dom ? har i många år tänkt avsluta eländet men dras tillbaka av mörka krafter men samtidigt som det ser ut med teknik idag är vi beroende av den. Jag har beslutat nu att säga upp nätet men hänger med under coronatiden för att hålla mig uppdaterad fast det gör man genom text tv också och behöver inte nätet för så bara där ser jag att det onda håller mig kvar i det här men det åker snabbt när det här med corona lugnar ner sig och stannar det kvar så åker nätet inom en kort tid för mig.

Det ligger något i det du skriver Skina att det är för mycket folk på jorden och det skapar misär i en del länder så universum tar hand om det och rensar ut inte på något sätt med straff tvärtom så vill universum befria andar som av olika orsaker behövs mer på andra sidan än här. Det måste inte röra sig om fattigdom,krig med mera för som vi ser så dör människor i länder med välfärd och bra liv men av någon orsak är dom klara och då kallas dom hem.

Vi ska alla gå den vägen en dag  och döden skrämmer mig inte och har aldrig gjort, ser och hör andevärlden precis som jag ser och hör människor så där är jag både trygg och övertygad  däremot det som kan kännas jobbigt är hur man går den fysiska döden till mötes men just övergången att komma hem den är jag helt trygg med. Jag tror ändå att är man där och oavsett hur jobbigt det än må vara för den fysiska kroppen så på något vis finner man en acceptans och ser vi på nuvarande kris så från början var det bara jobbigt men på något vis så växer man in i och lär sig leva med situationer och personligen känner jag att jag kommit in i en acceptans att så här är det nu men så klart hoppas man på att det här ger vika och  lika med den fysiska kroppens död så finner man sig och accepterar den situationen när man är där.

Allt har en mening och jordelivet är inte det liv vi ska sträva för däremot andra sidan och befrielsen det är den som är vår verklighet inte det liv vi lever här .

Vi ska självklart skapa livet positivt efter bästa förmåga men inte sitta fast i att det här är vår verklighet tvärtom ha medvetenheten och tilliten till att en dag befrias vi och lever i total harmoni på andra sidan .

skina
2020-04-16, 08:49
#38

Jag tror att det är fullkomligt naturligt, inte universum utan naturen. Om det blir för många av någon art så kommer det en sjuka som sprids snabbt pga det stora antalet individer.

Men om vi som är vakna och ljusa och ser vad som pågår på Internet kliver ur, då får ju andra krafter fritt spelrum att sprida mörker över jorden, tänker jag.
Internet är ju en del av våra liv numera, ska vi inte då ist försöka sprida positivt, klarsyn och värme som motvikt till mörkret som sprids över internet då? )
Tänker jag iaf :) Så hoppas ni får en fin dag :)

Carmarino
2020-04-16, 10:08
#39

#38 Har länge tänkt samma sak - långt innan coronaviruset dök upp. Det är naturens sätt att hantera överbefolkning, oavsett vilken art det gäller. Varför skulle människan vara förskonad från "naturens gång"?

Vi hittar botemedel för den ena sjukdomen efter den andra, men naturen hittar alltid nya för att försöka hålla befolkningsantalet nere. Det säger sig själv att jorden inte klarar att husera hur många människor som helst, även om många tror det.


¡ɹnʇɐuƃıs ɯos uǝp ɐɥ ɥɔo uǝʇxǝʇ ɹäɥ uǝp ɐɹǝıdoʞ ʇʇɐ ɹöɟ ɹɐlʞ åsʞɔo uɐʇn ʇɹɐɯs ɐɹɐq ǝʇuı np ɹä ɹäɥ ʇǝp ɐsä1 np uɐʞ

JRSN
2020-04-16, 10:18
#40

#37 #38 Jag tänker att Internet i sig varken är ont eller gott. Visst finns det faror och nackdelar men samtidigt är det en ovärderlig källa till kommunikation och information. Internet är inte på något sätt 'färdigt', skulle jag tro. Vi har haft ett ganska naivt och oskuldsfullt förhållningssätt till denna digitala plattform. Det vi behöver göra är att anpassa Internet även till förekomsten av demoner, som ju är elektriska av sin natur. Säkerhetstänkandet måste in på ett helt nytt spår, ett helt nytt sätt att tänka. Detta gäller inte minst utvecklandet av AI, för om den tekniken skall kunna användas fullt ut så krävs verkligen mycket säkra 'demonfilter'. 🌺

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

skina
2020-04-16, 13:49
#41

Min tanke är ju alltså att den mörka sidan sprider sin energi genom negativa tankar.

Så fröer till osäkerhet, otrygghet, misstänksamhet, mani, fobi osv osv

Så mitt "filter" är alltså att inte gräva ner sig så djupt, inte släppa in alla tankar från höger och vänster och framförallt inte släppa sådana negativa känslor in i hjärtat.

Som jag skrev förut. Jag hör och ser vad folk säger och skriver, men jag försöker alltid att inte ta ställning (lägger ingen energi) på det förrän jag vet med säkerhet att det stämmer. 
När jag var yngre var jag väldigt arg på hur den offentliga sektorn demonteras utan att någon bryr sig, att alla bara ser om eget hus osv. Men jag har insett att allt går i vågor, folk uppskattar inte vad de har förrän det är borta.
Resultatet var ju iaf att jag gjorde av med en massa energi helt i onödan, det ledde inte till någon revolution iaf, ha ha.
Så ur ett större perspektiv så måste vi nog få det sämre innan folk i allmänhet vaknar upp. 
Tror jag :)

Huygens
2020-04-17, 08:52
#42

Facebook kommer att kolla att du tänker rätt tankar. Faktum är att Facebook kommer säga åt dej vilka tankar du ska tänka. SVT

Enbart sådana tankar som Illuminati vill att du ska tänka. Är du en avvikare får du en tillrättavisning.

JRSN
2020-04-17, 09:31
#43

#42 Jo tack, det har jag redan råkat ut för. En video med alternativ tolkning av Coronaviruset stämplades som 'konspiration'. Dessutom går det inte att lägga till en person som 'vän' i Facebook, knappen saknas. Där har jag via mail talat med personen i fråga om 'icke godkända ämnen', tydligen. På något sätt har Facebook spårat detta och gjort en uteslutning. Obehagligt!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-17, 09:40
#44

Ja, ganska obehagligt.

wildfire
2020-04-17, 17:31
#45

#40 Jo jag kan hålla med dig där på sätt och vis men samtidigt ska vi inte glömma vilka krafter som skapat internet från början, vilken var orsaken och hur många vill vi fånga i vårt nät ?

Jag känner som så nu att jag hänger med så länge corona pågår men är det en pandemi eller är det skrämsel för att få oss alla att isolera sig. Jag är klen och det är inte roligt oavsett det heter corona eller annat så fick jag sån skit av en enda medlem på en sajt så jag håller tyst med hur jag mår just nu för man skäms ju att berätta och det är den ondes avsikt  att få oss att tystna 😕

Det jag tänker på är hur lurade kan vi vara, jag får meddelanden varje dag från andra sidan om plantering av viruset Biologiskt krig  är min guide på om 24/7 och han brukar ha rätt sen om omvärlden tar emot och ser är en annan sak för vi andliga har det inte lätt att komma fram med sanningar det vet vi sen förr långt tillbaka i tiden.

Jag har en kort uppgift nu som ska slutföras och den ska jag klara av i hopp om att ingen någonsin ska känna rädsla för vi är så omsluten av kärlek och ljus så om vi bara visste men vi måste ta emot och vila i den tryggheten att inget händer för vi är eviga, snälla förstå det vi är eviga allihop ❤️

JRSN
2020-04-17, 17:58
#46

#45 Är inte säker men tror att Internet från början var en rent militär form av kommunikationsplattform. Sen upptäckte andra nyttan och 'behaget' i att kunna tala med personer på ett enkelt sätt. Men vem initierade tanken hos militärer att ge sig i kast med projektet, demoner? Kanske var det så.

En pandemi är det ju. Sen om det är verkliga virus eller 'tankevirus' spelar kanske inte så stor roll. Resultatet blir nog detsamma. Visst är vi eviga! ☀️

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-18, 15:44
#47

Vet ej om denna blivit länkad till förut. Förklaringen till varför försöksdjuren dog av SARS-vaccinet runt år 2005 - 2008. Orsaken är skillnaden mellan neutraliserande (bindande-neutraliserande) och bindande (bindande-måltavleutmärkande) antikroppar. (wiki)

Man vill helst ha väldigt många fler neutraliserande antikroppar i kroppen. då neutraliserande inte är skadande mot celler utan bara mot virus. SARS-vaccinet skapade istället en enorm mängd bindande antikroppar som dödade försöksdjuren, då immuncellerna anföll egna celler i kroppen när djuren blev smittade med godtyckligt coronavirus.

Bindande antikropper kan nämligen binda till alla möjliga celler, bakterier och virus utan särskilt mycket urskiljning. Bindande antikroppar neutraliserar heller inte virusen, som kan fortsätta sprida sej som förut.

(YT/Children's Health Defense, 2020-04-11, 6 min)

Även RSV och Dengue vaccinen dödade barnen pga effekten med bindande antikroppar.

Kan det vara så att kineserna i sina mångmiljonprogram med vaccin fått SARS-vaccin? Och när dom sedan fick vanliga coronavirus, dvs vanlig förkylning, dog dom i förkylning pga vaccinet. Illuminati vet vad dom gör och Bilderberggruppen sköter mörkläggningen.

Wikipedia är rensopat på farorna med vaccin och relationen till bindande antikroppar.

Det säger något.

Dr Anthony Fauci driver agendan via NHI i USA.

JRSN
2020-04-19, 18:19
#48

#47 Det här är intressanta uppgifter. Läkemedelsföretag kan orsaka skada just på grund av att väldigt få är insatta i immunförsvarets komplexitet. Kontentan tycks vara att det är vaccin i olika former som immobiliserar kroppens naturliga försvar.

Samtidigt är jag förvirrad just nu på grund av mängden ny information som kommer upp. Detta gäller exempelvis uppgiften om att virus i sig inte kan orsaka sjukdom. Enligt denna facebookkälla är virus endast ett 'ämne' som cellen själv skapar för att göra sig fri från ansamlade; tungmetaller, plaster, gifter, rengöringsmedel och kemikalier. Virus är inte levande och kan enligt denna källa inte 'smitta' någon annan. Det enda sättet för virus att ta sig in i en annan kropp är - via vaccinationer!

Kanske existerar ingen motsättning mellan uppgifterna om neutraliserande resp. bindande antikroppar och uppgifterna om att virus överhuvud taget inte har någon möjlighet att reproducera sig i celler. Jag kan ännu för lite för att kunna uttala mig med någon säkerhet i frågan. Fortsättning följer.

Tillägg 20200420: Facebookkällans uppgifter om virus kan vara alltför kategorisk. Virus kan nog existera såsom 'parasiter' i cellmiljö. Men kanske har kroppen även användning av virus såsom en 'signalsubstans' gentemot andra personer i dess närhet. Viruset kan vara ett meddelande till andra individer att 'aktivera kroppens immunförsvar', eftersom ett eller flera patogener finns i närmiljön. Jämför med växter som meddelar sig med andra växter via ferromoner och med ämnen som transporteras via växtens rotsystem.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-20, 18:16
#49

Wow! Den här videon med Dr. Judy Mikovits öppnar inte upp Pandoras Ask. Men den ger en grundlig förklaring till den Pandoras Ask som redan är öppnad. Detta är sakkunskap som alla borde ta till sig. Som man kunde förvänta sig så är vår kropp expert på att ta hand om smittämnen. Detta förutsatt att kroppen inte är förgiftad och den ges adekvat näringstillförsel. Vacciner skadar kroppens immunförsvar!

Videon är nästan 2 tim. lång men väl värd att se:

CORONAVIRUS EXPOSED - DR. JUDY MIKOVITS

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-21, 20:00
#50

WHO säger att coronaviruset SARS-CoV-2 tillverkades inte i Wuhans BSL-4-laboratorium. REUTERS, 2020-04-21

Professor i virologi, Nobelpristagare Luc Montagnier sa i fransk intervju att coronavirusets struktur visar att viruset troligen tillverkades i ett laboratorium. SARS-CoV-2 är antagligen skapat av människor och molekyler har på konstgjord väg infogats i coronaviruset.

NewsMax, 2020-04-19
IB Times, 2020-04-18
(YT/Kelci/CNEWS, 2020-04-17, 4 min)
La Presse, 2020-04-17

Dubbel desinformation?

Huygens
2020-04-21, 21:45
#51

En något upprörd och överarbetad läkare, Dr Cameron Kyle-Sidell. (YT/C K-S, 2020-04-17,  7 min)

Kan det vara så att "ARDS" rör sej om ett genomträngningsproblem? Dr K-S vet ej, men funderar på vad syndromet skulle kunna vara.

JRSN
2020-04-21, 21:49
#52

#50 Vet inte om det stämmer, men enligt Dr. Judy Mikovits (ovan), så sker inte modifiering av virus på gennivå. Det man gör är att utsätta celler för olika typer av virus. Hos de celler som överlever har någon form av förändring skett. Dessa celler studeras sedan och slutsatser om ev. nya viruskombinationer görs.

Men om WHO påstår att SARS-CoV-2 inte tillverkats eller modifierats i något laboratorium så kan man väl nästan vara säker på att sådan modifikation faktiskt HAR gjorts. Dr. Mikovits hävdade också att de som tagit vaccinationer från 2013 och framåt löper större risker om de konfronteras med SARS-CoC-2, tvärtemot den allmänna uppfattningen om vaccinationer således. För varje vaccination som kroppen utsätts för, försämras kroppens förmåga att stå emot infektioner.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-21, 22:14
#53

#51 Det var svårt att hänga med i Dr. Kyle-Sidell's avancerade resonemang om syreupptagning på alveol-nivå. Men jag förstod så mycket att syndromet tycks förvärras av 'träning', dvs snabbare hjärtrytm. Syreupptagningen som sker mellan alveolen och blodkärlet sker långsammare än normalt. Ökad fart på blodströmmen innebär därför att färre syreatomer tas upp av blodet, patienten får syrebrist.

Man kan möjligen spekulera i att SARS-CoV-2 är konstruerad att fungera som en blockerare av syreupptagningen, men endast i kombination med något ämne som tillförts tidigare via 'influensavaccin'. Minst två faktorer krävs alltså för att utveckla Covid-19. 'Eliten' vill förstås inte riskera att själva drabbas. Om de, offentligt, har tagit vaccinationer så kan man utgå från att dessa endast innehållit koksaltlösning.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-21, 22:30
#54

Illuminati har gett myndigheterna som primärmål att pumpa ut desinformation och felaktiga uppgifter i syfte att sprida mer rädsla bland befolkningen.

6 miljoner svenskar smittade av SARS-CoV-2, drogs tillbaks. SVT
Antikroppstest kan ej säkerställas, uppgift drogs tillbaka. SVT

600 000 stockholmare smittade till 1 maj… SVT

#53 Om det inte är så att 5G och frekvenserna skadar något i kroppen som gör att syreupptagningen slutar fungera.

JRSN
2020-04-21, 23:57
#55

#54 Så kan det förstås vara, att 5G påverkar syreupptagningen. Nu är väl inte 5G så utbyggd ännu, åtminstone inte i Sverige. Men det lär vara så att 'Elon Musk' har placerat ut, eller planerar att sända upp satelliter i omloppsbanor på låg höjd som sänder ut 5G. Detta bör man nog ha lite koll på. Uppgifterna kommer från en intervju med David Icke.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-22, 07:57
#56

#55 Vi vet inte hur det är med sjukdomskällor skapade på konstgjord väg. På 1950-talet fanns det städer i USA där folk rapporterade sjukdomstillstånd under några års tid och mätningar av oberoende forskare visade då att intilliggande militärbaser skickade ut kraftiga sändningar med radarfrekvenser. När detta påpekades för militären och varningar från forskarna ökade, slutade militären skicka mikrovågor in över städerna och sjukdomstillstånden försvann; huvudvärk, hosta, illamående, magbesvär, sömnbrist etc. Jag har inte kvar länken till videoklippet, men den fanns på yt ett tag. Avhemligade CIA-rapporter från 1950-talet visar att CIA kände till att mikrovågor kunde användas som vapen mot soldater och kunde få dom att tappa tankeförmågan i strid.

Anta att man ökar fältstyrkan på befintlig 3G och 4G (som kan nå in i 5G-området) och på så sätt framkallar COVID-19-syndrom och ARDS. Då behöves ingen 5G i vissa områden. Det kan ju också vara så att militären med dolda sändare i särskilda frekvensband, skickar in mikrovågsstrålning, t ex nattetid, över valda delar av New York, där läkaren arbetar och på så sätt blir folk lungsjuka.

När multiföretagen sedan installerat 5G och folk fortsätter bli sjuka, kan man alltid skylla på COVID-19 och inget forskarinstitut får pengar för att tillåtas undersöka sambandet med 5G.

Locket läggs på och skulden för sjukdomseffekterna av 5G läggs på coronaviruset.

JRSN
2020-04-22, 09:20
#57

#56 Ja, i dessa dagar tycks ingenting vara heligt. Det är två saker jag inte har riktig koll på. Det är förhållandet 'signalstyrka' och 'frekvens'. Styrkan på befintliga 3G- och 4G-sändare kan förmodas kunna öka, bara genom ett knapptryck. I fråga om frekvensen kanske andra antenner behövs. 5G är ju mikrovågor, såvitt jag förstår, alltså kan man förvänta sig att nya antenner kommer upp. Men märker man att en förändring har skett? Befintliga antenner kanske byts ut under förevändningen att det handlar om 'underhåll'. Lurigt!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-22, 09:54
#58

Viss 4G-utrustning kan skicka frekvenser i det lägre 5G-området, men ja, det kommer antagligen upp nya särskilt anpassade antenner för just 5G, för att täcka hela frekvensbredden.

Dessutom måste 5G skickas med högre energiförbrukning som troligen sliter för mycket på gammal 4G-utrustning i längden. Mera energi, mera kWh, mera ström, mera destruktiv kraft.

Det är ju så att 5G-frekvenser stoppas av många material och därför har kort räckvidd, kanske bara 300 m. Det innebär också att omgivningen absorberar mer energi per längdmeter från 5G-antennen, då signalen avklingar (strålning absorberas och omvandlas till energi).

Det är den sistnämnda effekten som inte undersökts ordentligt. Vilka ämnen absorberar mest 5G-strålning inom ett givet frekvensintervall. Syre ska ju absorbera inom 40 - 60 GHz, med kanske toppen runt 60 GHz. Många kemiska och biologiska processer kräver molekylförändringar, omflyttning av atomer, atombindningar kan upphävas och ändras, vilket kan störas om det hela tiden matas på med strålningsenergier.

Jämför att barn som bor under kraftledningar får leukemi. Bildandet av blodkroppar, dom naturliga atomomfördelningarna störs lite lite av en smula extra elektromagnetisk strålning och plötsligt är den resulterande blodkroppen inte vad man vill ha, eller så störs benmärgen när den skapar blodkroppar och blir plötsigt förändrad när en atom får extra energi i bindningsögonblicket och hamnar där den inte ska vara, då bildas en cancercell. 

Likadant dom svaga atombindningarna, van der Waalskrafterna påverkas av 5G-strålning och sjukdomseffekterna på t ex cellskal är inte alls utredd. Tänk hudcancer från UV-strålning, men istället inne i kroppen av 5G.

Redan idag ger ju 3G och 4G skadliga effekter och detta har det varnats för av forskare.

Huygens
2020-04-22, 15:05
#59

Mer felaktigheter av myndigheterna för att framtvinga krav från allmänheten att "något måste göras", vilket underlättar Bilderberggruppens problem-reaction-solution. SVT

FHM drar tillbaka rapport. Rapporten är späckad med avsiktliga fel, i syfte att skapa rädslor hos befolkningen.

Bilderberggruppen.

Lösningen är redan utformad.

Problemen hängs upp för allmän beskådan.

Illuminati inväntar sedan befolkningens reaktion och kan därefter presentera sin "lösning" som svar på reaktionen till det artificiellt skapade "problemet".

problem-reaction-solution

JRSN
2020-04-22, 18:22
#60

#58 Det kan ju hända att det finns speciella isolerande material som kan sättas upp och skydda hemmet. Men det är absurt att vi ens måste tänka i de banorna, när det är den yttre strålningen som behöver uteslutas eller åtminstone reduceras. Jag testade ett par appar som mäter 3G-4G-5G-strålning, för att få ett hum om hur höga värdena är på olika ställen. Det fungerade men något märkligt hände; mobilen drog 2 gigabyte på bara en liten stund, trots att appen i fråga var stängd (är dock inte säker på att det var just den appen men misstanken finns, jag hade ju nyss laddat ner den). Ja, opinion behöver bildas mot 5G men frågan är om myndigheter bryr sig om sådan kritik. Snarare följer de allmänna direktiv som utgår från EU-nivå.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-22, 18:37
#61

#59 Förhoppningsvis börjar folk få upp ögonen för den här typen av manipulerat beslutsfattande. Jag var ute på stan i dag (Södermalm, Stockholm). Det är helt uppenbart att människor har tröttnat på Coronaskrämseln och går ut ändå; solar, går i affärer och på Caféer. Utmärkt! Det är helt orimligt att upprätthålla olika former av karantän utan skälig misstanke om faktisk smitta. Även om det fanns ett mycket påtagligt patogen som härjade så finns det alternativa sätt att hantera en sådan situation. Jag menar, vi har ju inte ens adekvata provtagningar som verkligen kan påvisa SARS-CoV-2, hur kan man då motivera generellt utegångsförbud.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-23, 21:45
#62

David Ickes son Jaymie Icke gjorde en intervju med läkaren Andrew Kaufman i början av april. Youtube raderade intervjun efter ett par dagar, men den finns nu på bitchute. Dr Kaufman anser att det saknas bevis för existensen av SARS-CoV-2. Något annat gör i så fall folk sjuka om det inte rör sej om manipulerad statistik.

Jag tror att det är här som Kaufman även tar upp exosomerna som gör att RT/PCR-testet ger utslag för "coronavirus" (får återkomma när jag sett hela).

(BC/DavidIcke, US Doctor: How can you make a vaccine for something never proven to exist?, 2020-04-09, 1 tim 17 min)

JRSN
2020-04-24, 06:59
#63

#62 Jag såg på videon ovan - How can you make a Vaccin for something never proven to exist? Mycket informativ och klargörande. De mystiska 'exosomerna' tas upp, men jag behöver nog se videon igen. Den är faktaspäckad och tydlig men eftersom en del uppgifter är så häpnadsväckande så är det ändå svårt att ta in. Exosomer sägs här vara 'enheter' som utsöndras av våra celler och hjälper till att undanröja toxiska ämnen. Dessutom sägs de fungera som en slags signalsubstans vilken har till uppgift att kommunicera något inom kroppen, kanske varna andra celler. Finns det i realiteten ingen skillnad mellan 'exosomer' och 'virus', det är frågan.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-25, 10:34
#64

För att forsätta på spåret som läkaren Andrew Kaufman öppnat kan vi titta lite mer på exosomerna. Dr Kaufman har en vanlig läkarutbildning i grunden, han har jobbat på cancerklinik och sedan erhållit specialisering i psykiatri och blivit psykiatriker.

Låt oss börja med begreppet organeller (wiki), en organell är ett slags "inre organ" i en däggdjurs- eller växtcell. Precis som vi har organ i kroppen såsom lever, njurar och lungor, har celler organeller, "organ" i cellen.

Dom flesta organeller stannar inne i cellen, men vissa organeller kan skickas ut av cellen för att gör olika saker utanför cellen, t ex samla in skadliga gifter som annars kan skada cellen eller för att skicka över immunförsvarsinformation och antikroppar till andra celler.

Om en cell dör och cellskalet kollapsar skickas också ett stort antal organeller ut ur cellen. Vissa organeller har samma form och utseende som virus och organeller som hamnar utanför celler blir därför ofta lätt tagna för att vara virus. Det kan vara mycket svårt och krävande att bryta isär organeller som liknar virus innan forskarna säkert kan säga om en viss organisk partikel är en organell eller ett virus.

Intressant i sammanhanget med AIDS är att inga sk "HIV-virus" någonsin isolerats och renframtagits. Dom bilder i vetenskapliga publikationer som visar "HIV-virus" är oftast bara organeller med en mängd nedbrutna cellrester.

Tyska forskare som noggrant undersökt AIDS-patienters blod har sagt att blodet varit helt rent från sk "HIV-virus". Det har aldrig hittats några "HIV-virus" i AIDS-blod. Ibland nämns HTLV-1 och HTLV-2 som sk "HIV-virus", men vi vet inte om HTVL-virusen ens existerar som AIDS. Troligen är allt kring AIDS en bluff för att lura oss följa en agenda av Bilderberggruppen. Det sk "HIV-testet" är en bluff som ger positivt HIV-slag utslag för 94 kända syndrom, inklusive graviditet, nyligen gjorda vaccinationer och influensa.

Upptäckaren Mullis av PCR (se #16) är en av dom många forskare som sagt att det saknas bevis för att AIDS orsakas av virus. Troligen är AIDS något helt annat och många sjukdomsfall av AIDS orsakas av behandling med AZT, på ett likartat galet sätt som italienska läkare dödat sej själva med kortisonbehandling mot fejksjukdomen "COVID-19" (se #16 ovan).

Begreppet exosom används för två typer av företeelser, som båda kan ses vara organeller. Exosomvesikler och -komplex.

Exosomvesikler (wiki) är små blåsor med vätska och biologiska molekyler. Exosomvesiklerna är det som Dr Kaufman avser i sin kritik av fejksjukdomen "COVID-19" medan exosomkomplex (wiki) fyller en (delvis?) annan funktion. Exosomkomplexen liknar garnnystan med grupper av 6 (?) olika proteiner. Funktionen hos exosomkomplexen är oklar, men verkar ha att göra med reglering av RNA-funktioner för proteinproduktion i cellen och hindrande av att allergier uppstår. Troligen utsöndras inte exsomkomplexen av cellen.  Det är troligen bara exosomvesiklerna som utsöndras av cell.

Så…

Exosomvesiklerna är små blåsor med biologiska material. Exosomkomplexen är små garnnystan av proteiner. Dvs dom är två olika saker, som olyckligtvis båda använde ordet "exosom" i namnet.

Exosomvesiklerna utsöndras hela tiden av celler och utsöndringen ökar vid sjukdom, om det finns gifter i närheten, vid stress, vid kontakt med antibiotika, närvaro av bakterier och virus. Blir man sjuk eller förgiftad ökar exosomutsöndringen kraftigt.

Exosomvesiklerna samlar upp gifter innan gifterna når fram till cellskalet och skadar cellen. Exosomvesiklerna överför även immuninformation och antikroppar mellan celler, ungefär som små brevbärare. Exosomvesiklerna kan ej föröka sej på egen hand, men verkar ibland ha någon typ av genetiskt material inne i sej, t ex RNA.

Exosomvesiklerna skapas och ansamlas inne i cellen i sk (eng)  multivesicular body (MVB), multicellulära kroppar, eller extracellulära vesikler (wiki). MVB fungerar som "skepp" som sedan skickar ut exosomerna ur cellen i 10-tals åt gången.

I elektronmikroskop ser exosomvesiklerna precis ut som virus. Det går inte att skilja mellan exosomvesikler och virus i mikroskop. Dom ser båda likadan ut.

Dr Kaufman beskriver sedan metoden med PCR som mycket väl kan reagera på DNA och exosomvesikler samt misstolka DNA/exosomvesiklerna för att vara virus. Människokroppen har 3 fantasiljoner baspar i vårat DNA.

RT/PCR-testet för "coronaviruset" söker efter sekvenser om ca 24 baspar som liknar någon del av godtyckligt coronaviruset av flera olika varianter. Samma sekvens av baspar kan mycket väl komma i någon ordning bland alla miljarder baspar i vårat vanliga DNA. Det innebär att PCR-testat som ska testa för "coronaviruset", testar antagligen bara för vårat egna DNA och ger utslag för "coronavirus" genom en reaktion på vårat egna DNA eller kanske t o m på något godtyckligt annat virus, som har samma sekvens av 24 baspar.

PCR-testet testar alltså inte på hela RNA-kedjan hos "coronaviruset"… Bara 24 baspar.

Dessutom finns det studier som visar att PCR-testat misslyckas i upp mot 80 % av fallen med både falska positiva och falska negativa resultat.

Två videor där Dr Kaufman förklarar exosomerna och både Koch och River's metoder för att identifiera virus. Metoderna är högst omoderna men används som rådande standard av vetenskapen för att detektera "coronaviruset", trots att dom färskaste rönen är från år 1937… Tänk på det.

Videorna innehåller vissa småfel, t ex tror Kaufman att "coronaviruset" först upptäcktes efter smitta på en fiskmarknad, men det är troligen inte så enligt Lancet.

(YT/Kaufman, 2020-03-31, 57 min) Den fejkade forskningen
(YT/Kaufman, 2020-04-20, 35 min) Mer om fejkforskningen

Det finns inga bevis för att det första SARS-viruset existerar. Det finns heller inget bevis för att SARS-CoV-2 (COVID-19) existerar. Alla bevis är fejk i kinesiska vetenskapstidskrifter som hänvisar till andra undersökningar som "bevis". Dom andra undersökningarna hävdar inga bevis och har bara undersökt enstaka patienter.

Alla bevis om SARS-CoV-2 (år 2019) och SARS (år 2002) bygger på rykten i vetenskapliga tidsskrifter. Ingen forskare har kunnat visa bevis för existensen av något av virusen.

Om dödsfallen i Wuhan är riktiga, är dödfallen orsakade av något annat. Chemtrails, 5G, gift i maten, gift i dricksvattnet, gifter i luften som sprayats ut, köld i bostäderna, influensa, kortison i i sjukhusbehandlingen etc.

Tänk också på att årets influensa är värre än normalt och minst 300 000 har dött av vanliga influensan i år. Många av dödfallen i influensa har troligen blivit registrerade som "COVID-19", trots att allt pekat på att dödsfallen är orsakade av influensan.

Coronaepidemin är fejk.

Dödsfallen är orsakade av annat än "coronviruset".

Huygens
2020-04-25, 10:50
#65

MVB kallas ibland även endsomer (wiki).

JRSN
2020-04-25, 14:04
#66

#64 Stort tack för djupgående information i frågan om Covid-19, cellens arbete med att rensa ut gifter och detaljer om 'exosomvesiklerna'. Från min grundläggande utbildning om mikrobiologi (kopplat till vårdyrken) så ingick verkligen inte så här pass avancerade studier om människans immunförsvar. Det är komplicerade samband det handlar om så jag tvivlar på om människor i gemen kommer att kunna ta till sig kunskapen. Samtidigt är det så pass viktigt att vi måste uppdatera oss!

Det som jag tror att många mestadels upplever som sjukdomen 'Covid-19' är den influensa som grasserar (och som sannolikt spridits via influensavacciner). Men de som initierat den här agendan planerar också för framtiden, på så sätt att Cov-19 ständigt skall hållas igång. Då är det ju lätt att 'späda på' med andra stressfaktorer som orsakar samma syndrom; 5G, chemtrails, stress, bakterier, gifter etc.

Sen kan det vara så att de som har tagit vaccinationer mot influensa under perioden 2013-2020 drabbas hårdare av Covid-19 (dvs olika stressfaktorer). Tror att jag hörde detta i intervjun med Judy Mikovits #49 ovan.

Mitt i allt elände så är det ändå skönt att veta att de virus som har utpekats som orsaker till smittan är fejkade. Det gör att rädslopåslaget släpper nästan helt!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-25, 16:24
#67

#66 Frågan är om ens läkarna vet så mycket om organeller, PCR och exosomvesikler. Troligen finns det bara en sjukvårdschef som säger åt läkarna att här kommer ett test från Big Pharma som detekterar "coronavirus" och så tror läkarna på det.

JRSN
2020-04-26, 08:42
#68

Nedan är en länk till en maratonvideo med läkaren Andrew Kaufman. Diskussion kring vacciner i allmänhet och deras förmodade verkan. Läkemedelsbolagen har total kontroll över produktionen och det går inte längre att ta del av exakt vad som finns i vaccinet. Inte ens läkare ges tillträde till fabrikerna där medlen framställs och de är heller inte intresserade. De följer blint tillverkaren råd och anvisningar.

Var och en gör givetvis som den vill i fråga om vacciner, om man skall ta dem eller inte. Dock ges vacciner rutinmässigt redan från spädbarnsstadiet och hur skall man då kunna yttra sig i frågan? Det blir föräldrarna som, ofta godtyckligt, följer givna anvisningar från barnavårdscentraler och primärvård. Hur skall de ha en rimlig chans att verkligen kontrollera preparaten, de har varken tid eller möjlighet.

Personligen är jag starkt kritisk till vaccinhanteringen. Jag vill på en mycket basal nivå ifrågasätta varför man överhuvud taget skall ta en helt onaturlig genväg in till blodbanan. Människans kropp är utvecklad i hundra tusentals år för att effektivt ta hand om och neutralisera patogener och gifter av olika slag. Vi måste kunna lita på detta geniala maskineri. Emellertid kan kroppen behöva grundläggande mineral och vitaminer för att kunna utföra sitt jobb, men detta är ett helt annat kapitel.

Vaccines vs Reality (2tim. 10min)

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-04-29, 10:36
#69

Skrev det här på annat ställe, men vet ej om det får vara kvar där. Lägger här också.
==================================================

Trust WHO (eller TrustWho) är en tysk dokumentär om WHO. Filmen är gjord år 2018 av Lilian Franck och Thomas Schlottman som är journalister och (kort-)filmsskapare.

Vi får följa WHO från början när organisationen ges i uppgift att mörklägga sambandet mellan cancer och tobaksrökning på 1950-talet. Ett flertal oberoende journalister som följt WHO genom åren ser en tydlig korruption och kontroll av WHO från dom stora läkemedelsföretagen. Karriärvägarna och samarbeten med Big Pharma är många och tydliga.

Olika tvivelaktiga vaccinationsprogram, den fejkade "svininfluensan", "broderpengar" och ett antal andra ljusskygga aktiviteter av WHO blir belysta.

Den nuvarande chefen för WHO, Tedros Adhanom Ghebreyesus (wiki) är medskyldig till ett folkmord på en folkgrupp som han inte själv tillhör i Etiopien under åren 2002 (ca) - 2015. Ett flertal utbrott av kolera inträffade under dessa år och Tedros A G förhindrade på olika sätt medicinsk hjälp och information till folkgruppen. Kolerautbrotten som upprepat bröt ut, beskrevs endast som "vattendiarre". Upp mot 2 miljoner människor kan ha dött i dessa tysta kolerakatastrofer. Wikipedia reviderar och tystar ner Tedros roll i koleraskandalerna som dödat 100 000-tals människor i Etiopien.

Tedros A G utsåg diktator Robert Mugabe som WHO Goodwll-ambassadör. Tedros utsåg diktator Mugabe på grundval av att Zimbabwe genomsyras av "god hälsa". Mugabe har mördat 100 000-tals personer i Zimbabwe som inte tillhör samma folkgrupp som han själv tillhör genom attacker av militär. Mellan 4 - 7 miljoner människor från Zimbabwe är flyktingar i andra länder pga Mugabes förföljelser och folkmord.

Mugabe själv använde inte Zimbabwes sjukvård, utan uppsökte sjukvård i andra länder.

Trust WHO har nyligen bannlysts från alla stora mediaplatformar efter det sk "coronavirusutbrottet". Facebook, Youtube, Vimeo, Twitter osv, har alla plötsligt tagit bort dokumentären. Enstaka trailers kan fortfarande hittas. Väldigt få artiklar på nätet går att hitta om TrustWHO.

Faktum är att all alternativmedia raderas i en rasande fart av dom stora mediaplattformarna om det finns minst antydan till upptäckter kring "coronaviruset", WHOs roll eller Big Pharmas aktiviteter.

Trust WHO (imdb)
JourneyMan Pictures (länk)
Collective Ev. (länk)
Global Research (länk)
(YT/OuterLight, 2020-04-28, 16 min)

JRSN
2020-04-29, 13:27
#70

#69 Jag såg ditt inlägg på 'Hälsa' iFokus. Man får väl hålla koll på om 'Trust WHO' möjligtvis dyker upp på 'BitChute' eller '3speak' så småningom. Även så pass stora organisationer som WHO är uppenbarligen korrupta (om de nu någonsin har varit annat). Det visar vilket bottenlöst träsk världen har sjunkit ner i. Sorgligt!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-29, 13:50
#71

En video med läkarna Dan Erickson och Artin Massihi från Kalifornien, USA. De går igenom statistik rörande insjuknade och döda i Covid-19 och jämför med den helt vanliga influensan som återkommer varje år. Vidare talas om risken med karantän; immunförsvaret försvagas mycket snabbt om vi förlorar möten via social kontakt.

Videon som hade över 5 miljoner tittare bannlystes från YouTube:

Covid-19 - Banned YouTube video (1.08 tim.)

Tillägg 20200429: Ovan nämnda läkare poängterar nödvändigheten att då och då komma ut bland människor. Om man vistas i karantän under två månader eller mer så försämras immunförsvaret ganska drastiskt. Vårt immunförsvar behöver ständiga 'influenser' från virus, bakterier och svampmikrober för att hålla sig i trim! Den syrehämmande sjukdom som läkarna behandlar på sin klinik är 'KOL' som står för 'Kroniskt obstruktiv lungsjukdom', eng. 'Chronic obstructive pulmonary disease'. Jämför SARS; 'Severe Acute Respitory Syndrome.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-04-30, 21:04
#72

Video här från en tidigare 'Vodafone-chef' som mer i detalj går in på sambandet 5G och 'Coronaviruset'. I korthet så kommer de starka mikrovågorna från 5G generera 'stressade celler' hos människan, vilket visar sig som influensaliknande symtom. Med ett annat ord kan man säga att cellerna blir 'förgiftade', och för att bli av med detta gift tvingas cellerna utsöndra 'virus', eller virusliknande enheter (jämför med diskussionen om 'exosomvesikler' i inlägget #64). 'Coronapandemin är således en täckmantel för en omfattande expansion av 5G-anläggningar, världen över.

Former Vodafone Boss blows Whistle on 5G-Coronavirus

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-01, 15:50
#73

#72 Ett tillägg: Någon påpekade att sprayningar med 'chemtrails' mer eller mindre har upphört sedan Coronautbrottet. Detta är intressant (på ett kusligt sätt). Det innebär att inget atmosfäriskt 'lager' bromsar inkommande ultraviolett strålning. Nuförtiden når även UV-C ner till markytan, vilket det inte gjorde förr om åren. Den 'artificiella solen' som är i omloppsbana runt jorden har detta spektrum. Det finns alltså en risk att UV-C bidrar till 'cellstress' enligt inlägget ovan. Allt för att öka på det sjukdomstillstånd som för närvarande skylls på Coronaviruset.

p.s. Ursäkta, talet om en 'artificiell sol' låter flummigt. Men vi lever i märkliga tider och teknologin till denna är redan patenterad och implementerad sedan många år.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-04, 14:51
#74

Följande resonemang är indirekt kopplat till Coronapandemin. Förekomsten och utsläppen av 'Chemtrails' är bevisat sedan lång tid tillbaka. Det är även känt sedan tidigare att dessa Chemtrails bland annat innehåller följande ämnen:

• Aluminiumoxid, partiklar
• Arsenik
• Bacilli (Grampositiva bakterier), Mögel
• Bariumsalter
• Bariumtitanater
• Kadmium
• Kalcium
• Krom
• Intorkade Mänskliga röda blodkroppar
• Etylendibromid
• Enterobacter Cloacae
• Enterobacteriaceae
• Mänskliga vita blodceller typ A (Kapar och rekombinerar DNA-strängar)
• Bly
• Kvicksilver
• Metylaluminium
• Mögelsporer
• Mycoplasma
• Nano-Aluminum-Täckt Fiberglas
• Kvävetriflourid (Metallstrimlor)
• Nickel
• Polymerfibrer
• Pseudomonas Aeruginosa
• Pseudomonas Florescens
• Radioactivt Cesium
• Radioaktivt Torium
• Selen
• Serratia Marcscens (Gramnegativa bakterier)
• Vassa titaniumskärvor
• Silver
• Streptomyces
• Strontium
• Mikroskopiska partiklar (Innehållande levande biologiskt material)
• Oidentifierade bakterier
• Uran
• Gula svampmycotoxiner

Men, i samband med Coronaepidemin verkar utsläppen ha upphört. Detta är fullt logiskt eftersom nästan all kommersiell flygtrafik är inställd. Det skulle med andra ord bli alldeles för uppenbart om chemtrailstråken fortsatte obehindrat. Men är luften nu klar och frisk utan nedsläppen. Inte vad jag kan märka! Fortfarande blir man 'sträv' i hals och lungor efter en dag utomhus. Vad är det då som sker?

Utsläpp av chemtrails verkar fortsätta som förut, fast med 'annan teknik'! Det finns en misstanke att satelliter nu återupptagit sprayningar på mycket hög höjd. Detta ger inga märkbara molnstrimmor. Utsläppen faller ner i form av mikrodroppar, en osynlig 'ånga' som människor och djur dock andas in. Till detta läggs Elon Musk's armada av lågtflygande satelliter (med 5G?), en mycket toxisk omgivning skapas.

Vi blir uppenbarligen förgiftade på en mängd olika nivåer och resultatet blir att vi utvecklar mångfaldiga sjukdomstillstånd som ofta ger influensaliknande symtom. Diagnoserna bakas numera samman till EN grunddiagnos - Corona, Covid-19.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-06, 17:32
#75

Ett par videor här från Dr. Robert O. Young, som i ett slag vänder upp och ner på hela förståelsen av sjukdomar, immunförsvar och patogener som bakterier, mögel och virus. Young talar mer om den 'miljö' som våra celler existerar i, nämligen det mellanrum (interstitium) som finns mellan huden och cellerna. Han benämner detta som kroppens största och kanske viktigaste organ. Om inte 'interstitium' är i balans vad gäller PH-nivån så blir vi sjuka. Virus, bakterier och mögel är då endast 'symtom' på obalansen, de är inte sjukdomsalstrande i sig själva.

Den första videon är mycket bra men tyvärr blir ljudet då och då så pass förvrängt att det är svårt att höra vad som faktiskt sägs. Huvudbudskapet går dock fram.

Dr. Robert O. Young: What is a Virus?

Som tur är finns en video som har getts ut tidigare med liknande information. Här är kvalitén mycket bättre även om den inte tar upp Coronapandemin i sig:

The PH Miracle with Dr. Robert O. Young

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-06, 23:39
#76

En video som tar upp några studier som visar att hemoglobinet och blodet får svårare att ta upp syre när mobilstrålningen närmar sej 60 GHz. (YT/Zoon Politicon, 2020-04-26, 10 min)

JRSN
2020-05-07, 10:19
#77

#76 Det är ju ett extremt misstänkt 'sammanträffande' att man valt just 60 GHz för 5G-bandet när dess påverkan på hemoglobinet är nästan obefintligt vid frekvenser just innan detta värde. Detta ses väldigt tydligt i diagrammet på sidan nedan:

5G, 60 GHz, Oxygen Absorption, You, and Coronavirus

Det är precis som om man medvetet vill orsaka så stor skada som möjligt!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-08, 00:18
#78

I intervjun Rose / Icke 3, nämner Icke att sjukhusen i USA får 4000 $ i statlig ersättning om dom får in patienter med vanlig lunginflammation.

Om sjukhusen istället rapporterar att det är COVID-19 lunginflammation får dom 13 000 $ / patient.

Om sjukhusen i USA dessutom sätter COVID-19-patienten i ventilator, för att styra andningen, får sjukhusset 39 000 $ i ersättning. Vad gör läkarna mest motiverade att diagnosticera och ordinera?

Condor
2020-05-08, 13:58
#79

Nu har jag letat efter vetenskapliga rön gällande konspirationsteorin, att 5G förändrar rotationshastigheten av syremolekylerna i luften och att hemoglobinet inte kan ta upp det "förändrade" syret.  Enligt konspirationsteorin ska det inte finnas ett coronavirus, utan symptomerna orsakas av 5G och syrebrist.

Gälande rotationshastigheten av molekyler, så roterar de alltid i olika hastigheter, beroende på temperaturen. Ju högre temperaturen är, ju snabbare är rotationen.  Om temperaturen sjunker till den absoluta nollpunkten, slutar rotationen upp helt.  Jag har inte hittat en enda studie som skulle visa att förändringar av  rotationshastigheten skulle leda till försämrad transport av syre i kroppen. Har ni som ställer in videos, där de pratar om studier,  letat fram dessa och läst dessa? Kan ni ge mig en länk till en sådan studie?

Sen finns det ju en hel del länder som är hårt drabade av coronaviruset, som inte ens har 5G, t.ex. Iran. Hur får ni det att gå ihop? Hur får ni det att gå ihop att antalet sjuka och dödsfall inte ökar lika mycket i länder som tar till stränga åtgärder mot corona? Jämför gärna Sverige med Österrike. När Österrike tog till sina åtgärder gick kurvan ner, medan Sverigs kurva fortsatte att stiga. Aktuellt har Sverige över 3000 dödsfall medanÖsterrike bara har 600.  Aktuellt har Österrike bara haft 20 dödsfall de senaste 6 dagarna, medan Sverige har runt 90 dödsfall per dag.  Dessutom ökade användningen av internät och mobiltelefon signifikant i länder som gjorde en "lockdown".  Skulle teorin stäma, borde ju sjukdom och dödsfall egentligen ha ökat i dessa länder i stället för att minska.

Visst, mobilstrålning är skadlig och kan görs människor sjuka, men det verkar som om den här konspirationsteorin inte går ihop.

JRSN
2020-05-08, 19:43
#80

#79 Det framgår ganska tydligt av sajtbeskrivningen att 'skeptiker undanbedes'. Där finns också regler angående användare som avkräver bevis av andra. Hoppas du respekterar dessa regler. Tack!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-09, 00:38
#81

Till att börja med kan en viss portion eftertanke vara nyttig, för just nu pumpar CIA och Kina ut massvis med desinformation för att få "konspirationsteoretiker" att framstå som dumma eller för att kunna skylla på Putinlojala ukrainska hackare när det kommer till mörkläggningen av effekterna från 5G. CIA-marionetter låtsas vara "konspirationsteoretiker" för att uppnå den avsedda effekten och få allmänheten att avfärda självständigt tänkande.

Mikrovågor kan få olika typer av molekyler och atomer att vibrera vid olika frekvenser. En vanlig mikrovågsugn har en frekvens runt 3 GHz som påverkar just vattenmolekyler att vibrera snabbare och snabbare tills vattnet kokar, dvs vattnet värms upp.

Vad vi inte vet är vilka andra effekter än just uppvärmning som existerar. Alla biologiska processer genomgår kemiska reaktioner. Om mikrovågor, t ex högspänningsledningar, verkar vid fel tillfälle kan det ge negativa effekter. T ex drabbas barn av leukemi som bor under högspänningsledningar och lokförare som kör malmtåg med kraftiga magnetfält från starka motorer, får hjärntumörer.

Syre, O2 påverkas vid 40 - 60 GHz och vid ett frekvensband till som jag inte minns. Det innebär att alla biologiska processer kan påverkas i dessa 5G-frekvensband som påverkar syret.

Svaga länkar i atomer, t ex van der Waalskrafter påverkas också efter långvarig utsättning för mikrovågor med olika frekvenser. Faktiskt redan vid 3G och 4G. Dessa van der Waalsbindningar är mycket vanliga mellan biologiska molekyler i hjärnan, som kan skadas och orsaka defekter och sjukdom. Leukemi var extremt ovanligt på 1950-talet. Idag är det legio inom sjukvården.

I USA har chefen för FCC, Tom Wheeler, sagt att FCC-myndigheten kommer förhindra alla biologiska och medicinska undersökningar av 5G, för att säkerställa att 5G installeras i hela världen utan att allmänheten får reda på dom skadliga effekterna.

https://youtu.be/sSMwSRzz0U4 (6 min, Tom Wheeler)

Lyssna och leta info, för den raderas i ett rasande tempo av youtube. Enstaka videor kan fortfarande hittas från år 2018.

Sambandet mellan 5G och fejksjukdomen "COVID-19" är mer komplicerat än vad som syns på ytan. Man måste tänka smart, tror jag. Dom krafter som verkar i skuggorna, har haft årtionden på sej att planera vad som sker nu.

Condor
2020-05-09, 11:12
#82

#80

Jaha…..  men eftersom jag själv inte betraktar mig som skeptiker, tänkte jag att det inte gäller för mig.  Jag betraktar mig bara som en som söker sanningen och jag är lika ovälkomen bland skeptiker som jag är här. Hur lite välkomen man som reikiutövare bland skeptiker är, borde du som  också är reikiutövare veta. Skeptiker har en förutfattad föreställning om saker som de inte förstår sig på och de intresserar sig inte för sanningen.

Jag visste inte att ni heller inte intresserar er för sanningen, för vem som vill veta vad sanning är, letar efter studier och fakta. Det gjorde jag och jag hittade ingen studie som skulle visa att förändringar av syremolekylers rotationshastighet minskar hemoglobinets förmåga att transportera syret. Eftertsom ingen här kunde länka till en sådan studie, har jag ändå fått svar på saken. I så fall ber jag om ursäkt att störde er i er utövande av er tro och jag önskar dig att du en vacker dag upptäcker meningen av reiki principerna och då menar jag speciellt principen "just nu är jag sann mot mig själv".:  http://www.reikitidningen.se/reikiprinciperna

Huygens
2020-05-09, 11:22
#83

#82 Vem har sagt det till dej? Vad menar du med syrets "rotationshastighet"? Vad innebär "rotation"?

Condor
2020-05-09, 11:49
#84

#83

Huygens, du skrev ju själv i inlägg 26 "Dana Ashlie i #3 noterade att syre O2 - kan påverkas av 5G, frekvensområdet tror jag var 40 - 60 GHz. Vilket i sin tur kan påverka syreupptagningen i kroppen."

Sen finns det studier som visar hur mycket av olika frekvensers energi som absorberas av syret i luften. Syremolekyler absorberar ju också energin av t.ex. värme, som också förändrar rotationshastigheten, så det är väl inget sensationelt att även strålningsenergi absorberas av molekylerna. För övrigt är det frekvensen mellan 59 och 60 GHz som absorberas mest (98 %). 

Ända tills den här punkten är det vetenskap. Men enligt konspirationsteorin ska detta ha effekten att det "förändrade" syret inte kan tas upp och tansporteras av hemoglobinet. Vetenskapliga studier eller belägg för detta har jag inte hittat. Om du själv skriver att detta kan påverka syreupptagningen i kroppen undrar jag om du själv har letat efter fakta?

Huygens
2020-05-09, 15:01
#85

#84 Nej, Dana Ashlie säger inte det du påstår om "rotationshastighet". Du har inte svarat på frågorna. Jag frågar igen:

Vem har sagt det till dej? Vad menar du med syrets "rotationshastighet"? Vad innebär "rotation"?

Vad är syrets "rotationshastighet"?
Vad innebär "rotation"?

Condor
2020-05-09, 15:47
#86

#85

Jag har inte själv tittat på klippet, men litar på att hon säger det som du skrev: "att syre O2 - kan påverkas av 5G, frekvensområdet tror jag var 40 - 60 GHz. Vilket i sin tur kan påverka syreupptagningen i kroppen."

Om man sen googlar för att ta reda på vad som är anledningen till påverkningen av syreupptagningen i kroppen hittar man sidor som förklarar det. Här är t.ex. en sida där författaren länkar till olika källor, men tyvär inte till studier:

https://www.cgc.ch/5g-und-corona-virus-2/

Dina frågor:

1.  "Vad menar du med syrets "rotationshastighet"? "

Jag skrev syremolekylernas rotationshastighet och det är hastigheten som molekyler roterar runt deras tyngdpunkt.

2.  Vad innebär "rotation"?

Molekylär rotation är rotationen av molekyler runt deras tyngdpunkt.

3. Vad är syrets "rotationshastighet"?

Det finns ingen konstant hastighet, utan den beror på temperaturen. Vid minus 273,15 grader stannar rotationen helt.

Här kan du läsa hur man kan räkna ut hastigheten:

https://sv.wikipedia.org/wiki/Maxwell%E2%80%93Boltzmannf%C3%B6rdelning

Condor
2020-05-09, 16:06
#87

Tillägg:

Det finns t.ex. belägg för att röntgenstrålning ger molekyler en ultrasnabb rotation:

https://www.uppsalauniversitet.se/nyheter-press/nyheter/artikel/?id=12136&typ=artikel

Principen gäller för all sorts tillförelse av energi, oavsett om det handlar om värme,  röntgenstrålning eller mobilstrålning. Det har visat sig att syremolekyler absorberar mest energi av frekvenser mellan 59 och 60 GHz, dvs. 5G nätet.  Så långt stämmer alltså teorin. Det som fattas är studier eller undersökningar som visar att denna tillförelse av energi, som ökar molekylernas rotationshastighet, skulle leda till försämrad upptag och transport av syre i kroppen.

Huygens
2020-05-09, 17:42
#88

#87 Du refererar till en sammanblandning av molekylers fysiska rörelser som uppstår när en elektron stöts bort från molekylen av röntgenstrålning och den energihöjning som uppstår av 5G-mikrovågsstrålning mot atomer. Dessutom, den tyska artikeln verkar blanda kvantfysiskt spinn med fysisk rotation. Spinn räknas inte som en rörelse i sej utan är en kvantfysisk egenskap hos elementärpartiklar. en intern egenskap.

T ex måste du rotera en elektron två varv för att rotera elektronens spinn ett varv. (wiki). "To return the particle to its exact original state, one needs a 720-degree rotation."

Spinn är ej fysisk rotation.

En elektrons spinn kan dessutom inte ändras. En elektron har alltid 1/2 spinn (netto, uttryckt i Plancks konstant). Elektronen kan alltså inte ändra sitt spinn från 1/2. (wiki)

Jag har inte sett någon video som pratat om att syrets rotationshastighet ändras som följd av 5G. Jag tror att det är någon annan mekanism som resultat av mobilstrålning som påverkar syret och därmed syreupptagning.

Jag tror att det råder missförstånd här på något sätt. Om jag åter ger min bild på saken. Ifall biologiska molekyler ständigt utsätts för mikrovågsstrålning, sker en slumpmässigt, i tid ojämnt fördelad, energihöjning i det yttre lagret av elektroner hos atomerna.

Vid biologiska och biokemiska reaktioner som sker ständigt varje sekund i stor omfattning i biologiska varelser, kan energiförändringar resultera i oönskade biokemiska reaktioner.

En möjlig orsak till skador och sjukdom av mobilstrålning är att dom resulterande biologiska produkterna, enzymer, proteiner, hormoner, antikroppar etc, som slutresultat inte får korrekt kemisk form. Dom defekta molekylerna kanske innehåller samma antal atomer av samma sort som korrekta molekyler, men placeringen av atomerna är felaktig, med negativa biokemiska effekter som följd.

Jag har inte hittat något vetenskapligt om denna "rotationshastighet" du nämner, men för all del, det kanske finns. Jag har dock inte hittat något.

Jag tror att mobilstrålningens effekter är resultat av energiförändringar i atomer i molekyler vid ögonblicken av biokemiska reaktioner. Precis när reaktionerna inträffar.

Fel mängd extra energi vid den biokemiska reaktionen, kan göra att den resulterande molekylen, t ex ett enzym, får cancerogen effekt.

Vad gäller syreupptagning och mobilstrålning är det ett kapitel för sej. Jag har dock inte hittat något vetenskapligt som nämner "rotationshastighet" hos syret och syreupptagningen.

Condor
2020-05-09, 18:32
#89

#88

Den tyska artikeln är faktiskt en artikel som stöder och förklarar konspirationsteorin, så om du hittar fel i den beror det på att den inte är skriven av vetenskapare, utan av konspirationsteoretiker.

Själv använde jag mig av ordet "rotation" och eftersom du kan tyska kan du gärna läsa att det är korrekt: https://de.wikipedia.org/wiki/Molek%C3%BClrotation

Jag förklarade det också rätt, jag citerar mig själv: "Molekylär rotation är rotationen av molekyler runt deras tyngdpunkt"

som du själv kan läsa här: https://wikidiff.com/spin/rotation

"rotation is (chiefly|uncountable) the act of turning around a centre or an axis while spin is circular motion. "

Men författaren av artikeln kanske inte kände till skillnaden. I alla fall förstår man att han talar om rotationshastigheten.

Den enda förklaringen som konspirationsteoretiker tills nu har givit är att det är just förändringen av rotationshastigheten som är problemet.  Du själv ger ju ingen annan förklaring, utan skriver allmänt om biokemiska reaktioner. Jo, dessa har det alltid funnits och på tiden som man använde sig av lägre frekvenser (90-talet, när de första mobiltelefonerna kom ut) fick man ett hett huvud om man telefonerade lite längre tid.  Det beror på att låga frekvenser tränger djupare in i kroppen än  höga frekvenser, så jag tvivlar på att 5G är skadligare för kroppen än de gamla frekvenserna. Just därför argumenterar konspirationsteoretiker med påverkningen av syre i luften, som ska ha effekten att syret inte kan transporteras lika bra.  Men det påstås bara helt utan vetenskapliga undersökningar eller studier. Det är så att säga en ren tro.

Huygens
2020-05-09, 19:05
#90

#86 Den hastighet du refererar till i Boltzmanfördelningen är inte "rotationshastighet". Gaslagen (en av flera) ger genomsnittshastigheten för en syremolekyl O2, som är ca 500 m/s.

Det innebär att en syremolekyl i gasform studsar runt mot andra atomer (och fasta föremål) rätlinjigt. Syremolekylen har alltså rätlinjig rörelse, i en riktning, tills kollision uppstår och riktningen ändras, fortfarande som rätlinjig rörelse, ungefär som en bil som färdas rakt fram på en väg. Genomsnittshastigheten 500 m/s på O2 är inte normalfördelad, högre hastigheter är mediandistanserade.

Visst, gasmolekylen kanske snurrar runt också, men det mesta av rörelseenergin (dvs värme) i Boltzmanfördelningen kommer från den rätlinjiga rörelsen. Om det finns en koppling till mobilstrålning, det är väl möjligt, men jag har inte riktigt sett det, annat än som uppvärmning, tänk: mikrovågsugn och en kopp vatten. Vid längre avstånd sker betydligt mindre uppvärmning.

Och skadorna från mobilstrålning / kraftledningar (magnetfält), på längre avstånd, kan därför inte vara av uppvärmning. Någon annan typ av biologisk effekt måste finnas, som ej undersökts ordentligt.

Har du verkligen inte hittat någon artikel om biologisk påverkan på biologiska varelser av mobilstrålning?

#89 Kan du hitta en bättre vetenskaplig artikel på engelska eller svenska?

Om jag inte finner en bra förklaring, funderar jag alltid på om jag läser desinformation av CIA/Kina/Bilderberggruppen/etc, just i syfte att utmåla "konspirationsteoretiker" i negativ dager. Det sker hela tiden. Och du verkar hitta websidor med högst beskedligt underlag och blygsamma logiska resonemang.

Hur vet du att du inte sprider CIA-desinformation, med målsättning att smutskasta "konspirationsteoretiker", på samma sätt som CIA gör i sin instruktion Dispatch 1035-960?

JRSN
2020-05-09, 22:36
#91

Jag är inte ointresserad eller likgiltig vad gäller pågående debatt men har svårt att skriva där jag är nu. Återkommer!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-10, 11:01
#92

#90

Hyugens, om du läser wikpediaartikeln om molekylrotation, kan du läsa:

"Nach der Boltzmann-Statistik sind bei höheren Temperaturen mehr Rotationszustände angeregt als bei niedrigeren"

Vad som betyder mer rotation vid högre temperaturer, enligt Boltzmann-statistiken.

Men vad jag vill säga är att all sorts energi som absorberas höjer rotationshastigheten och värme är en energi precis som mobilstrålning. Jag har inte påstått att skador från mobilstrålning  är uppvärming, även om strålningen leder till uppvärmning, utan jag tog värmen som ett exempel på en energi som också höjer rotationshastigheten.

På tiden som de första mobiltelefonerna kom ut och som man fick ett hett huvud av när man telefonerade fanns det många studier om skador. T.ex. råttstudier där man konstaterade att om man bestrålar råttorna med mobilstrålning eller strålning av DECT telefoner leder det till att albumin hamnar i hjärnan, som i vanliga fall inte tränger igenom blod-hjän barriären. Men strålningen gjorde  barriären otät och det betyder att strålningen öppnar blod hjärn barriären även för andra gifter. Men dessa lägre frekvenser gick mycket djupare in i kroppen än de höga frekvenserna av nutidens strålning och 5G.  Därför får man nuförtiden inget hett huvud längre.

Påverkningen på kroppen var alltså värre förr än av de nutida högre frekvenserna.  Just därför argumenterar konspirationsteoretiker med att 5G påverkar syret i atmosfären och då argumenteras det med rotationshastigheten.  Det står även i länken som JRSN länkade till i inlägg 77:

"They’re heating, in part, by impacting those molecules to rotate or oscillate with each wave."

Där finns samma diagram som i den tyska artikeln som jag länkade till och även där är man inte så noga med att skilja mellan rotation och spin, som du kan se.

Du ska läsa ordentligt, för jag förnekar ju inte att det finns en fysisk negativ påverkan av mobilstrålning, utan det är just det "förändrade" syret som inte kan tas upp och transporteras av hemoglobinet som jag inte sväljer ner utan att först se en vetenskaplig undersökning eller åtminstone en teori som baserar på någon sorts fakta eller medicinska rön om varför syret inte skulle kunnas ta upp eller transporteras lika bra. Du har ju heller inte givit mig en förklaring till hur det skulle gå till.

Enligt dig, om jag har förstått dig rätt, anser du att det inte har med den atmosfäriska påverkan av syre i luften att göra, utan påverkning direkt på kroppen, men du kan inte tala om för mig varför syret inte skulle kunnas tas upp lika bra.

Condor
2020-05-10, 11:08
#93

Tillägg:

För övrigt intresserar jag mig inte för CIA och sprider heller inte ut någonting, utan jag sammanfattar vad konspirationsteoretiker säger och kommenterade att det bara är vetenskapligt korrekt ända tills en viss punkt (rottionshastigheten) men att det sen inte existerar någon sorts fakta om hur det påverkar syret och hemoglobinets förmåga att ta upp och transportera syret. Om du hittar någon sorts fakta kan vi gärna diskutera om det.  Jag hittade i alla fall ingenting.

Condor
2020-05-10, 11:21
#94

#91

JRSN, jag ville också ge dig en förklaring till vad jag skrev til dig i inlägg 82 om reiki principerna dvs. om principen "just nu är jag sann mot mig själv".

Om min föreställning av världen skulle bero på vad andra säger, utan att själv fundera och ta reda på hur saker och ting ligger till, skulle jag inte vara sann mot mig själv, för det skulle inte vara "min sanning" utan då skulle det bara vara "min tro".  Det som du skrev till mig i inlägg 80  betyder för mig att du som reikiutövare inte tillåter en annan reikutövare att följa reikiprincierna i ditt forum.

JRSN
2020-05-10, 19:05
#95

Hejsan, jag är tillbaka på banan efter att ha hjälpt till med en flytt som tog ett par dagar i anspråk. Nu blir jag närvarande lite oftare.

Condor: Du har en lite märklig 'attityd' eller vad det är, svårt att sätta fingret på. Jag förstår över huvud taget inte 'reikiprincipen'. Den enda princip som reiki har är att 'energin går dit där den behövs', det är allt jag vet.

Den här sajten är inte vetenskaplig. Det är högt i tak och man behöver inte ha några belägg för det man säger (bra argument är förstås ett plus). Man kan således påstå egentligen vad som helst om man håller en god ton och är lyhörd för vad andra tycker. Vad är det för skillnad att 'hålla på sin sanning' eller 'hålla på sin tro', jag kan inte förstå att detta spelar någon roll.

Det känns som att du är allmänt skeptisk mot konspirationsteorier när du skriver. Detta blir ju ett bekymmer för mig eftersom mer än 50 procent av det jag skriver faller inom kategorin konspirationsteori, på något sätt. Men många konspirationer visar sig sedemera vara sanna, så varför kan man inte prata om dem?

Sen kan det ju hända att det finns irritation mot mig personligen, eller mot andra för den delen. Men då är det bättre att ventilera detta via PM. Dissusionstrådar bör vara neutralt hållna och äga rum i ett gott samtalsklimat.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-10, 20:50
#96

Jag håller på och grunnar på en rätt intressant teori, enligt mig själv förstås, och som nästan alltid är det väl en konspirationsteori. I samband med att Coronakrisen bröt ut så upphörde så gott som all flygplanstrafik. Följaktligen borde luften ha blivit åtskilligt bättre på mycket kort tid, frisk och klar. Men, så var inte fallet, när man andas utomhus så märks fortfarande den där 'sträva' känslan och den mycket påtagliga lukten av 'brända kretsar', bränd metall. Även när det är molnfritt!

Så vad är detta? Jag har nu en teori som jag tycker verkar trovärdig. I fråga om UV-stålning så har man alltid låtit oss förstå att UV-C hejdas i ett visst skikt uppe i atmosfären. Men så är det inte längre, flera oberoende personer har mätt UV-C ända nere vid markytan. Orsaken kan vi kanske lämna därhän tills vidare.

Men vad händer när UV-C interagerar med syreatomer? Misstanken är förstås att molekylärt syre (O2) fragmenterar av den högfrekventa UVC-strålningen, även på marknivå. Enskilda syreatomer förenar sig sedan med molekylärt syre och bildar ozon (O3). Ozon är giftigt och kan ge skador på hud, ögon och lungor. Om ämnet numera förekommer rikligt även på marknivå, är det då orimligt att tänka sig en koppling till lungproblem hos Coronapatienter? Är det i själva verket ozon som i vissa fall orsakar lungskador enligt typen 'Kroniskt Obstruktiv Lungsjukdom'?

Edge of Extinction: A Science Lesson and UV-C Radiation

Deadly Ultraviolet UV-C and UV-B Penetration to Earth’s Surface

Mechanism of Ozone Formation and Ultraviolet Absorption

Ozon - Wikipedia

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-11, 10:36
#97

#95

Jag är mycket förvånad att du inte lärde de 5 reikiprinciperna i din utbildning.  Dessa lärs ut när man gör den första graden.  Mikao Usui tog upp dessa i sin lära, men han var inte författaren. Det var den dåtida japanska kejsaren som författade runt 100.000 "wakas" som ansågs vara lika heliga som buddistiska sutras.  Han författade dessa för att ge folk en andlig inspiration.  En av dessa var de 5 principerna som Usui tog upp i sin lära.

Det finns olika översättningar och det diskuteras mycket om dom bland reiki utövare om hr de ska tolkas och uppfattas. Jag tycker att översättningen på sidan som jag länkade till är bra. En del översättningar väcker intrycket att man som reikiutövare inte t.ex. får oroa sig längre och det klarar ingen människa av. En ännu bättre översätning finns det i Fran Browns bok, där hon t.ex. skriver att man ska släppa loss sin oro.  Det är lättare att klara av. Jag har själv skrivit en artikel om dessa principer som publicerades i ett tyskt reikimagasin.

Det som du nämner att reiki flyter dit där den behövs är ingen av dessa principer, utan lärs ut i reiki kurser bland andra saker. Jag kan inte bekräfta att det stämmer, utan tvärtom, om man vill att ryggsmärtor försvinner, måste man behandla ryggen och inte knät eller huvudet.  Skulle energin flyta dit där den behövs, skulle man inte behöva lära handpositioner. Därför tog jag inte med dessa i det som jag lär när jag själv blev reikilärare.

Det är en stor skillnad mellan sanning och tro. Tror gör bara folk som inte känner till sanningen, men jag föredrar att säga att jag inte vet om jag inte känner till sanningen och försöker att komma på sanningen. Att leva i en osanning är ingenting som stöder den egna andliga utvecklingen, utan tvärtom.

Reiki är ju heller inte vetenskap, men man kan erfara effekten. En annan sak är det med konspirationsteorier och om man baserar dessa teorier på vetenskap och gör vetenskapliga uttalande (hemoglobin, förändrade syremolekyler t.ex.) ska man åtminstone kunna stöda vetenskapliga uttalande med vetenskap. eller erkänna att det bara är misstankar som det inte finns vetenskapligt stöd för. Annars är det lurendrejeri och man lurar även sig själv.

Jag känner ingen irritation mot din person eller mot andra här och har inte varit ovänlig mot någon.  Jag bekämpar ingen som inte delar min åsikt och om jag ser att någon är på "fel väg" försöker jag att ge insikt md hjälp av logiska argument. Men jag förstår att du kanske har gjort samma erfarenheter med skeptikerrörelsen som jag och kanske är känslig mot kritik och för snabb med att klassa andra som skeptiker.  Men det är en del av den andliga vägen att inse hur man reagerar och att försöka att se människor som det som de är och inte sortera in människor i olika byrålådor.  Det är ett mönster som så gott som alla människor har, men som man på en andlig väg försöker att bli av med, för att leva i sanning och att se sig själv och andra som det som de verkligen är.

JRSN
2020-05-11, 12:57
#98

#97 Min reikilärare måste ha glömt att nämna dessa fem principer, eller så valde hon att inte ta med dem av något skäl. Men hon var generellt mycket skicklig och samvetsgrann och jag har inte haft någon anledning att ifrågasätta hennes sätt att undervisa. Jag tror dock att alla reikilärare gör en 'tolkning' av det de lärt sig själva.

Det är ganska anspråksfullt att säga sig veta sanningen. Man kan ha sina hypoteser och ha starka argument för dessa. Men att påstå sig kunna bevisa någonting över huvud taget bör man nog vara väldigt försiktig med. Ju djupare man tränger in i filosofins väsen om tingen och tillvaron, desto djupare i mystiken hamnar man.

Jag förstår inte hur du menar dig kunna skilja ett vetenskapligt uttalande från ett icke vetenskapligt. Menar du att jag inte får uttala mig om t.ex. 'hemoglobin' om jag inte gör det utifrån några slags 'vetenskapliga kriterier', det låter mycket märkligt. 

Många tycks tro att man måste bevisa ett uttalat påstående, för att över huvud taget få säga det. Detta är givetvis galet. Jag tror man förväxlar 'bevisläget' med det som gäller i rättegångar och rättstvister. Där har man en tydlig motpart och målet måste avgöras åt något håll. Av naturliga skäl behöver man då lägga fram sina fakta om det man åberopar. Men - allmänna diskussioner är inga rättstvister!

Jag skulle vilja hänvisa till 'Teman Cooke's' omtolkning av den vetenskapliga metoden. Den känns mer 'naturligt ödmjuk' eftersom man inte slår in några slutsatser i sten. Endast hypoteser som sedemera kan komma att förändras:

Teman Cooke at TEDxLancaster

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-11, 14:11
#99

#98

Jag kan inte uttala mig om din reiklärare, för jag känner henne inte, men i och för sig är reikiprinciperna en del av traditionell Usui reiki och man nämner dom inte bara i kurser, utan man pratar om dom och förklarar.

För somliga är reiki dock bara ett verktyg för att hjälpa sig själva eller sina nära, men för andra är det också en andlig väg. Det som vi kallar reiki är bara en liten del av en gammal buddistisk lära, där det ingår saker som meditation och kroppsliga övningar och som bara utövades i kloster. Det var en andlig lära.  Eftersom reiki är en andlig energi arbetar den på alla som initieras även på andlig nivå. Reikiprinciperna är en sorts ledtråd som inte bara folk som sysslar med andlig utveckling/personlighetsutveckling kan följa utan alla människor kan reflektera över dom och över sig själva med hjälp av dessa.

För andliga saker existerar inga bevis.  T.ex. kan man inte ge en vetenskaplig förklaring för att distansreiki fungerar, varken med fysik eller biologi. Man kan bara erfara det. Men det finns ju heller ingen som använder sig av fysiska termer i artiklar eller forum och hittar på saker för att väcka intrycket bland folk att vetenskapen har kommit fram till att distansreiki fungerar eller till och med kan förklara det fysiskt eller biologiskt.

Jag menade egentligen inte att man inte får uttala sig om saker som man inte kan bevisa. Men man ska tala om att det bara är ens personliga åsikt och inte väcka intrycket att det existerar t.ex. medicinska undersökningar som har visat att strålning påverkar hemoglobinet eller att syret i luften påverkas på ett sätt att det inte kan tas upp eller transporteras av hemoglobinet.  Det finns det bara 3 möjligheter för att sprida ut sånt: 1. det existerar verkligen medicinska undersökningar. 2. Man har läst det och tror på det. 3.  Man har hittat på det.

Internätet är ju fullt av alla möjliga påståenden och många gör sig inte mödan att kolla om de verkligen stämmer.  Men om jag läser sånt, vill jag veta om det baserar på vetenskap, tro eller fantasier.  Man kan givetvist ställa upp en hypotes helt utan vetenskap och diskutera om den.  Man kan väga upp vad som talar för och emot, men man ska inte väcka intrycket att det finns någon sorts vetenskaplig fakta bakom den om den inte verkligen existerar.

Jag har ju nämnt ett par saker som talar emot hypotesen att viruset inte skulle existera och att folk skulle bli sjuka av 5G.  T.ex. att Iran drabbades hårt utan att 5G existerar där. Men det var ingen som var intresserad av att svara på det eller reflektera över det. I stället uppfattades det som att jag generellt skulle anse att strålning inte är skadlig alls och du klassade mig som skeptiker, som inte är välkommen här.

Som sanningssökare och sanningstalare är man inte välkommen bland de flesta.  Jag är varken välkommen hos skeptiker eller bland forum som det här. I politiska forum är jag varken välkommen hos vänstern eller högern.  Människor (de flesta) vill inte höra och se sanning. De har förutfattade åsikter och skapar sig sin egen värld som de lever i.  Min sambo Fata Morgana  (och jag är också hennes reikilärare) gör nu samma erfarenheter och frågar mig vad det beror på. Hon säger "egentligen vill jag vara vän med allla, både höger och vänster, både skeptiker och folk som skeptikerna är skeptiska mot".  Men det går inte.  Många missuppfattar henne och ibland försöker hon att förklara någonting som man egentligen inte kan förklara med ord och som beror på hennes egna andliga erfarenheter. 

Hon frågar ibland vad det beror på och jag brukar förklara för henne vilka tankemönster som ligger bakom bland folk och hur de är funtade. Ibland tar jag som exempel att folk som Krishnamurti eller Osho gjorde precis samma erfarenheter.  Osho sa en gång att han inte är fiende med någon, men många är fiende med honom.  Andliga erfarenheter och insikt förändrar inte bara individen själv, utan även omvärldens reaktion på individen.

JRSN
2020-05-11, 15:20
#100

#99 Du vill veta vad det är du läser, det är förståeligt. Men saken är att du aldrig kan veta något om vare sig källa, bakgrund eller sanningshalt. Inom silverhantering använder man som bekant stämplar för att visa äkthet, silverhalt etc. Men givetvis är detta inte en garanti för någonting. Till syvende och sist måste man alltid kolla själv om man vill 'pröva andarna', som någon klok man sade. Nuförtiden talas det mycket om 'fake news', vilket vänds åt olika håll. Gemene man vill ha garantier för att informationen är sanningsenlig. Detta begrepp är förstås endast en illusion.

Jag brukar säga så här; "det finns inget 'fake news', det finns bara 'news". Allt det som presenteras på internet eller i böcker kan, för en själv, vara matnyttigt eller inte. Att tillåta någon annan att rangordna informationen är inte bara olämpligt, det kan vara direkt skadligt och vilseledande. All information behöver vägas på guldvåg och man måste själv göra det. Finner man något som passar in i ens egen hypotes så kan man använda det. Sen kan det uppstå antiteser ur hypotesen, vilket kanske leder till en syntes. Men den syntesen är fortfarande bara en- hypotes!

För ett tag sedan skrev jag ett resonemang om fakta. Texten ville visa att det man kallar 'vetenskap' är minst lika flummigt som någon annan typ av forskning. Det är bara det att vetenskapen har förvärvat en överdrivet stark ställning i samhället.

Du behöver inte läsa den, jag har skrivit ner den mest för min egen skull:

Vad är egentligen fakta

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-11, 16:51
#101

#100

Om någon påstår saker rakt ut i luften uten att tala om varför det skulle vara som han påstår, kan man inte veta någonting om källa, bakgrund eller sanningshalt. Om man har en vetenskaplig källa, en medicinsk undersökning osv.  kan man förstås inte vara helt säker, för det händer också fel inom forskning, men man vet åtminstone hur personen kommer fram till det som han påstår och kan själv bedöma hur trovärdig  som man anser att källan är.

Om personen påstår saker utan att kunna tala om varför någonting skulle vara som han påstår minskar trovärdigheten.  Nu kan förstås personen förhindra detta genom att lura folk. Pesonen kan t.ex. säga någonting som inte går att veta utan motsvarande medicinska undersökningar, t.ex. om hemoglobin eller syre.  Då kan det hända att en del antar att det existerar sådana undersökningar. Det funkar mest med läsare som inte har mycket kunskap om saken. Men om läsaren tycker att det där låter konstigt och frågar efter en källa blir det pinsamt för författaren om han inte kan presentera en källa.  Då blir det uppenbart att författaren försöker att manipulera folk genom att få eget tyckande att se ut som medicinsk fakta. Det är lurendrejeri.

Här handlar det inte om att rangordna "informationer" utan att skilja mellan informationer och fantasier eller eget tyckande.  Att presentera en egen tro som fakta är det som kan vara skadligt och vilseledande. Att tro att det inte existerar ett virus leder till att den troende inte är försiktig med sig själv och sina medmänniskor. Det kan leda till att man smittar andra, som i sin tur ger smittan vidare til andra och i slutändan finns det människor som dör pga andra människors tro.

I ditt inlägg 96 har du åtminstone förklarat vad din nya teori baserar på, så det är helt ok. Men jag undrar varför dina teorier går ut ifrån att viruset inte existerar och att det är något annat som dödar människorna. Ozon i luften är ett problem som vi har sen längre tid och därför mäter man ozon och ger varningar om det överstiger ett visst värde.  Men det kan inte vara ozonet som gör att folk dör i mängder i flera länder. Ozon är skadligt för lungorna, men man får inte högt feber av det. Dessutom kan man ju förfölja utspridningen av viruset och iakta var i världen som det sprider sig mest och vilka effekter restriktioner har som länder inför.

Man kan lätt se var "virusbomberna" fanns. T.ex. var det ett CL spel mellan Atlanta Bergamo och Valencia i Italien med många åskådare.  Därför spred det sig först i Italien och sen i Spanien. England drabbades hårt för att de fortfarande spelade CL och engelska ligan, när andra länder spelade utan åskådare. Sen tog folk med viruset från Italien till ett skidområde i Tirol. Där bildades nästa hotspot och många skandinaviska skidturister tog med viruset till Skandinavien.

Man kan ju iakta att lockdown och andra restriktioner fick sjukan att minska i olika  länder.  De länder som reagerade innan de hade allt för många smittade, t.ex. Finland eller Österrike har betydligt mindre sjuka och dödsfall än länder som reagerade för sent.  Varken ozon eller mobilstrålning reagerar på utgångsförbud, munskydd och att hålla avstånd från varandra.

JRSN
2020-05-11, 23:56
#102

#101 Det här är lite min poäng. Vi har ägnat spaltmeter här åt 'vetenskapsteorier' och källhänvisningar. Men i trådens inledning framgår tydligt att syftet är att finna alternativa förklaringsmodeller till Coronapandemins ursprung. Detta vill du dock inte göra utan gör långa utläggningar för att ifrågasätta de hypoteser som har lagts fram. Ursäkta, men detta gör dig faktiskt till en skeptiker, vilket var skälet till att jag hänvisade till sajtens regler, som bland annat slår fast att 'skeptiker undanbedes'.

Det här är inte en sajt som argumenterar för argumenterandets skull. I likhet med din sambo så älskar du att diskutera. Detta är inte fel i sig men bör ske på passande sajter, kanske 'Vetenskap', 'Filosofi', 'Andlig skepticism' och liknande. Jag vill inte lägga ner massor av tid och kraft på att finna vattentäta bevis, som ändå inte går att presentera, därför att sådan bevisföring  är en omöjlighet. Det jag är intresserad av är 'rimlighetsanalyser', dvs att undersöka om hypoteser kan anses vara trovärdiga.

Jag vill absolut inte vara ovänlig utan vill bara påpeka att diskussionen i den här tråden har fått fel fokus. Vill man finna nya infallsvinklar i ett ämne, i det här fallet Coronapandemin, så kan man inte nagelfara specifika fakta in absurdum. Då går diskussionen i stå och man når inte fram till någonting alls.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-12, 07:58
#103

Jag tycker Condor vid tillfällen helt lämnat ämnet om "coronaviruset" och skrivit långa tröglästa inlägg om fullkomligt orelaterade saker. Det gör det svårt för den som vill läsa om sånt som är relaterat till ämnet att vada igenom all den orelevanta texten. Visst kan man ibland behöva lämna ämnet för att förklara någon detalj, men jag tycker Condor gått för långt och borde startat separata trådar om dessa orelaterade ämnen.

Dessutom tycker jag det är tveksamt att Condor utnyttjar en tysk artikel som, innehåller ett uppenbart faktafel (den felaktiga sammanblandningen av "rotation" och kvantfysiskt spinn) för att dra långtgående smutskastande slutsatser i syfte att smutskasta alla Condor anser är "konspirationsteoretiker". Alla dras över en kam, i samma stil som CIAs Dispatch 1035-960. Är målet bara smutskastning?

Om vi återgår till ämnet så har vi mer bevis för att det sk "coronatestet", RT/PCR-testet, som enligt Nobelpristagaren Kary Mullis inte kan användas för att ställa diagnos, är fejk och visar helt barocka reslutat vid diagnos av påstådd "COVID-19".

Bl a måste WHO förklara varför patienter som blivit friska från "COVID-19" fortfarande testar positiva i sjukdomen. Patienterna måste alltså fortfarande vara sjuka i "COVID-19", trots att dom är friska. Den officiella förklaringen från WHO är bl a att patienterna inte blivit immuna mot fejksjukdomen "COVID-19". SVT

För att förklara den logiska kullerbyttan ytterligare om fejksjukdomen "COVID-19" säger WHO att patienterna, som alltså är friska, men samtidigt sjuka i "COVID-19", inte har fått immunitet.

Faktum är att WHO säger att väldigt få patienter alls får immunitet, för att förklara dom många positiva RT/PCR-testen, på "tillfrisknade". Endast 1 - 10 % blir immuna mot fejksjukdomen "COVID-19" enligt WHO.

Om man är sjuk i fejksjukdomen "COVID-19", hur kan man då bli frisk om man inte fått immunitet? För om man inte fått immunitet mot viruset, har immunförsvaret inte lyckats lista ut hur viruset ska bekämpas. Att bli immun innebär att immunförsvaret lyckat skapa rätt sorts antikroppar. Och om man inte blivit immun mot en virussjukdom, kan man inte heller bli frisk från virussjukdomen, då viruset inte stoppats och förstörts, utan viruset fortsätter obehindrat att multipliceras i antal.

Visa forskare kanske anar att "COVID"-testet inte funkar och säger att RT/PCR-testet testar positivt för att "rester" av viruset finns kvar i kroppen. SVT

Jaha, men hur vet forskarna då att det inte är "rester" som testat postitiva i första läget och patienten är sjuk i något helt annat, t ex influensa.

Och rester…

Det är precis så exosomvesiklerna fungerar, rester av RNA från exosomerna ger positivt utslag i RT/PCR-testet. Dvs "COVID-19"-testet detekterar mänskligt RNA, ursprung vårat vanliga DNA och RNA-översatt i exosomerna för att kunna producera viktiga proteiner som motverkar gifter och hjälper immunsförsvaret.

"COVID-19" är alltså bara blandat mänskligt genetiskt material, troligen kombinerat med allt annat möjligt genetiskt material från alla möjliga bakterier, bakterierester, andra virus, sönderbrutna rester av andra virus, genetiskt material från svampinfektioner mm.

"COVID-19" är fejk. Mänskligt RNA + andra organismers RNA.

Däremot vet vi inte helt utav vad dom olika svårare sjukdomsfallen beror på, bl a ARDS och det är där bl a mobilstrålning och 5G kommer in i dom hårdare drabbade områdena i världen.

Italienska läkare kan ha dött av att dom felbehandlat sej själva med höga doser kortison, men norra Italien har också höga nivåer luftföroreningar, tänk chemtrails och norrra Italien har mycket 4G och 5G.

Sjukdomsrapporteringen är alltså en blandning av orsaker, men hur mycket högre dödligheten är än normalt är oklart om den ens är högre ifall man borträknar dödsfallen från den säsongsinfluensa som florerar och är svårare än vanligt.

Kineserna kan ha dött i miljontals i och runt Wuhan, men då troligen av gifter, sprayande i luften och annat skadligt som spridits på order av Kinas Kommunistparti. Kina har hysteriskt höga halter luftföroreningar och lift extra gift i luften kan få katastrofala effekter.

Wuhan har dessutom full 5G installerad.

Huygens
2020-05-12, 09:04
#104

Även värt att notera: "De allra flesta antikroppstesterna tillverkas i Kina med över 90 företag på marknaden." Sveriges Radio

Mer tvivelaktigheter från WHO "Det finns i nuläget inga bevis för att personer som tillfrisknat från covid-19 och har antikroppar är skyddade mot en andra infektion." Sveriges Radio

Jaha.

Men hur kunde i så fall patienten "tillfriskna" från fejksjukdomen "COVID-19" om denne inte är skyddad från infektion trots bildandet av "antikroppar"? Logisk kullerbytta, som allmänheten tydligen sväljer.

JRSN
2020-05-12, 10:30
#105

#103 #104 Exakt, det finns ingen som helst logik i alla motsägelsefulla påståenden, och de är många. Hela testproceduren är total geggamoja eftersom det påstådda viruset inte ens har isolerats. Därför kan viruset inte heller verifieras eller avfärdas genom Kochs postulat och man kan definitivt inte framställa ett seriöst vaccin mot en sjukdom som inte existerar, eller möjligen bygger på helt andra orsaker.

Man kanske som sagt bör kalla sjukdomen 'Trams-20' istället!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-12, 13:22
#106

Fick denna nyhet skickad till mig. Tanzanias President John Magufuli har tydligen huvudet på skaft och litar inte blint på forskarnas information. En 'get' och en 'pawpaw-frukt' testades för Covid-19; testerna var positiva! Testerna skickades förstås in såsom tester på människor med namn och ålder. Detta visar dock att tester för Covid-19 är godtyckliga och, i dubbel bemärkelse, ett skämt!

Goat and fruit test positive for Covid-19

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-12, 13:42
#107

#106 Om det är sant att en bit av en frukt kan ge utslag i det sk "COVID-19"-testet, då är fejkandet värre än vad Dr Kaufman trott.

Condor
2020-05-12, 14:36
#108

#102

JRS,  det är ok att hitta alternativa förklaringsmodeller, men även dessa måste basera på någonting annat än bara misstankar och får inte stödas med saker som verkar att vara påhittade, exempel hemoglobinet.  Sen ska du veta att om man ställer upp en teori inom vetenskapen, så försöker man själv att vederlägga sin egen teori för att att ta reda på om den är sannolik. Men ni verkar inte att vara öppna för det, för att ni blundar för argumenten som jag tog fram. T.ex. har fortfarande ingen svarat på frågan, varför Iran som inte har 5G är så hårt drabbad. Ni har bara fokus på Wuhan.

Nu är det så, att även om hemoglobinet skulle påverkas av 5G, så är det för lite för att dra slutsatsen att alla som blir sjuka inte har Corona, utan är skadade av 5G. Det finns för mycket som talar emot, så jag har inget tvivel att viruset existerar. Men vad som intresserade mig är vilka skador som 5G kan leda till, för man vill ju veta om det är bättre att skaffa sig 5G eller att behålla det som man har. Allt är skadligt, men frågan är vad som är minst skadligt.  Om jag läser att hemoglobinet påverkas av 5G vill jag så klart veta mer om det. Men om ingen kan referera till någonting,  måste jag anta att det är påhittat av någon och att ni tror på det utan att vara skeptiska.  I stället är ni skeptiska mot den som vill veta sanningen, som ni inte verar att intressera er för. 

Alla är skeptiska mot något och varför skulle man inte få vara det utan at klassas att vara en skeptiker. Om vi inte alla är skeptiker, för att vi alla är skeptiska mot någonting, kan jag bara tolka det som att du klassade mig som någon från skeptikerrörelsen.  Dessa skeptiker har också bara en tro.  T.ex. tror de att saker som reiki,  qi och över huvud taget energier som inte går att mäta inte existerar, bara för att de inte går att mäta. De intresserar sig heller inte för sanningen, för de testar ju inte ens ut det. De har redan en föruppfattad åsikt om saker, precis som ni här.  Eftersom jag intresserar mig för sanningen, är jag obekväm för dom som inte intresserar sig, för sanning kan ju få en tro att rasa ihop.  Därför är man som sanningssökare och sanningstalare varken välkommen här eller andra forum (skeptikerforum).

Om det skrivs inlägg i det här forumet om vetenskap, dvs. hemoglobin, syremolekyler osv. är det klart att jag svarar här och inte i ett av de forum som du nämnde. Om du inte vill att det ska diskuteras vetenskap här, måste du säga det till dom som började att diskutera med vetenskapliga termer och inte till den som svarar på det.

Condor
2020-05-12, 15:38
#109

#103

Hyugens, nu ska du inte säga att jag smutskastar någon, för det gör jag inte.  Citera gärna vad du uppfattar som smutskastning, så ska jag gärna förklara. Tvärtom har jag argumenterat mycket sakligt och bara för att argumenten innehåller kritik är det ingen smutskastning.  Det var för övrigt inte jag som påpekade faktafelet spin/rotation för första gången, utan det var du själv i artikeln som jag länkade till. Sen påpekade jag bara att samma faktafel finns i din egen länk. So what???

Det verkar som om du ofta kanske läser för snabbt eller ytligt och nu ska jag visa dig vad du tolkar fel i det som du refererar till i ditt inlägg.

Jag citerar dig:  "Faktum är att WHO säger att väldigt få patienter alls får immunitet, för att förklara dom många positiva RT/PCR-testen, på "tillfrisknade". Endast 1 - 10 % blir immuna mot fejksjukdomen "COVID-19" enligt WHO.  "

Sen länkar du till WHO och nu citerar jag ur länken:

"Flera studier i Europa, USA och Asien visar att endast mellan en och tio procent av personerna som testats hade antikroppar mot viruset.  "

Ser du skillnaden?  mellan en och tio procent som testats hade antikroppar och inte att en till 10 procent som testades positivt/var sjuka hade antikroppar.  Meningen med studierna var att ta reda på om folk (och hur många) har utvecklat flockimmunitet eller inte.  Om faktan som du drar en slutsats med är fel pga att du missuppfattar en text, kan slutsatsen heller inte stämma. Det är alltså inte bara mellan 1 och 10 % som blir immuna.

Grejen med konspirationsteorier är att de levererar enkla förklaringar för komplexa frågor, men saken med antikroppar, tester osv. är mer komplexa än dina slutsatser. Det stämmer vad du skriver och citerar, att PCR testen inte duger som diagnos. Det beror inte på att testen är så kass att den inte kan skilja mellan ett influensavirus och coronavirus, utan det beror på att den inte kan skilja melan ett aktivt levande virus och rester av ett virus efter en infektion.  För den sakens skull finns det antikroppstester.  Man testar både IgM antikroppar och IgG antikroppar.  IgM antikroppar bildar kroppen  medan viruset är aktivt, men först när man har varit sjuk ett par dagar.  Därför kan man inte testa en nyinfketion.  Vill man vara helt säker, måste man göra både en PCR test och en antikroppstest.

IgG antikroppar har man dock i blodet längre tid och det är dessa som ger immunitet. Tills nu finns det inga undersökningar om hur många personer som hur länge har dessa antikroppar.

Att Wuhan har 5G har du ju nämnt, men du bryr dig inte att länder som Iran inte har 5G och ändå är hårt drabbade.

Till slut finns det inga andra informationer om grejen med geten och frukten som du skriver om i inlägg 106 än en enda människas påstående, dvs. Tansanias president, som redan förr har gjort galna uttalande om corona. Här kan du läsa mer om det och även hurvida testobjekt kan kontamineras. 

https://www.zdf.de/nachrichten/panorama/coronavirus-papaya-ziege-tansania-test-100.html

JRSN
2020-05-12, 17:37
#110

Signaturen 'Condor' har belagts med en varning för ohörsamhet mot sajtregler. 😕

Sajtvärd, JRSN

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-12, 18:08
#111

#110

Vilken sajtregel har jag brutit mot?

JRSN
2020-05-12, 18:17
#112

#111 Kolla i ditt PM.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Huygens
2020-05-12, 19:08
#113

#108 Jag upplever att du resonerar bakvänt lite hela tiden och du kommer med undergrävande tvivelaktigheter rätt så systematiskt. Jag tvekar att alls svara dej, för dina resonamang har ett inbyggt mått av enfald. Att t ex förklara Iran måste vara så busenkelt, att jag bara antog att du redan fått klarhet. Är du verkligen allvarlig i din fråga om Iran?

Alla företag i Iran, alla myndigheter, all näringsverksamhet, alla maktpersoner i Iran samt hela befolkningen i Iran har allt att vinna på att "coronakrisen" utmålas som så svår som möjligt. Samtliga i Iran har allt att förlora på att "coronakrisen" av omvärlden inte upplevs som speciellt svår.

Allt att vinna.

Och allt att förlora.

Valet är då enkelt.

Riksdagsledamöterna i Iran sjukanmälde sej och lägger sej in på sjukhus i massvis. Hälsoministern i Iran åt antagligen fyra tuggor het rödpeppar och smorde pannan med vaselin, så att han kunde stå och svettas "febersjuk" på presskonferensen. Sjukhusen påstås sedan rapportera 1000-tals sjuka och döda i "corona". Media i Iran målar givetvis upp ett fejkat skräckscenario med sjuka.

Det är lätt att skapa falsarium i en diktatur. Om 400 är sjuka i influensa eller om 4 miljoner är sjuka i fejket "COVID-19", kan lätt fabriceras av envåldsstaten Iran. Diktaturstaten Iran har allt att vinna på att omvärlden tror att "corona" drabbat Iran svåras i hela världen.

Hur är det möjligt att du inte insett det med samma? Jag har ingen lust att svara på fler frågor med uppenbara svar.

FataMorgana
2020-05-13, 10:18
#114

#102 

Egentligen skrev jag inte att jag älskar att diskutera, utan jag skrev att jag älskar att skriva. Hade jag älskat att diskutera hade jag väl inte öppnat en blogg, utan snarare tagit över en sajt här på iFokus. Men visst kan det vara vara roligt att diskutera ibland också, men i allafall var det inte så jag skrev. 

Men hur som helst hade ju du och Huygens kunnat skriva att det där med  hemoglobinet bara är en hypotes och inte presenterat det som fakta. I sådana fall hade jag och Condor knappast funderat över varifrån ni fått det ifrån och inte ställt er den frågan här. 

Ni ser, vi har ett genuint intresse för medicin och hälsa och älskar att ta reda på fakta och lära oss mer. Att ta reda på hur saker och ting verkligen ligger till är för mig inget som gör en till en skeptiker, men jag förstår att det främmande för er och att ni därför inte kan föreställa er hur andra människor fungerar och att ni därför drar fel slutsatser om andra och missförstår dem.

Condor
2020-05-13, 10:33
#115

#113

Jag upplever att du tillskriver mig smutskastning, fast det är du som kastar smuts på mig. Jag upplever att du tillskriver mig enfald, fast det är du som är enfaldig och inte ens kan läsa det som du refererade till.  Du missuppfattade texterna om tester och antikroppar och jag förklarade sakligt hur det ligger till, men i stället för att vara tacksam att du lärde något övergår du till personangrepp.

Gällande Iran ser jag att du inte har ett riktigt argument, utan bara en ny konspirationsteori. Att stöda en konspirationsteori med en annan snurrig konspirationsteori är vad jag kallar enfald.  För övrigt var Iran en av länderna som först försökte att tona ner faran och muslimerna gick demonstrativt omkring och slickade heliga monument. Men det har väl ingen mening att argumentera logiskt när du lever i din egen värld.

Condor
2020-05-13, 10:36
#116

Tillägg:

JRSN skrev till mig i ett PM "Du kunde lagt fram en egen hypotes om varför Iran är så hårt drabbat men det har du inte gjort."

Därför lägger jag fram den nu:

Min egen "hypotes" gällande Iran är att de har så många sjuka och så många dödsfall, fast de inte har 5G för att folk inte dör av 5G utan av ett virus.

JRSN
2020-05-13, 11:30
#117

#114 Det finns inga entydiga 'fakta', det finns bara hypoteser. Punkt.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-13, 11:59
#118

#117

Det har varit en hypotes att jorden är platt.  Har den nu bytits ut mot en ny hypotes, att den är rund eller är det fakta?

JRSN
2020-05-13, 12:06
#119

#118 Det finns många hypoteser. Välj en, och tala för den på ett konstruktivt och inspirerande sätt. 🏆

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-13, 14:11
#120

#119

Ska jag tolka det som så att det bara är en hypotes att jorden är rund, som inte väger mer än den gamla hypotesen, att jorden är platt? Menar du att det är 2 likvärdiga hypoteser?

FataMorgana
2020-05-13, 14:18
#121

#117  

Naturligtvis finns det entydig fakta. T.e.x är det entydig fakta att jorden är rund. Förr trodde man att den var platt, men idag vet man att den är rund och samma sak är det med medicinska rön. Vad som är utforskat är utforskat som t.ex att människan i regel har 33 kotor i sin ryggrad och det kan jag t.o.m själv verifiera att stämmer om jag tittar på mina magnetröntgen bilder och räknar dem och samma sak är det med hemoglobinet. Endera är det utforskat att 60Ghz påverkar hemoglobinet eller så är det inte utforskat. Så länge det inte är utforskat är det bara en hypotos, men så fort det är utforskat är det inte en hypotes längre, utan sen vet man och jag trodde att ni visste något om hemoglobinet när ni uttryckte er som att ni visste något om det. My bad, sorry för det. Men för mig är det i allafall en stor skillnad mellan en hypotes och fakta och för mig finns det gott om av både och.

JRSN
2020-05-13, 19:08
#122

#121 Ska man ägna sig åt hårklyverier så är ju jorden faktiskt inte rund, mera som en 'knycklig potatis'. Det är först när man lägger till oceanernas vatten som jorden blir någorlunda rund (eller sfärisk). Men inte helt, för jordens rotation får ju vattnet att bukta ut något vid ekvatorn. Så helt entydiga fakta är det nog inte.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

JRSN
2020-05-13, 22:05
#123

Ännu en läkare talar ut om de totalt överdrivna farorna av Covid-19.

Another Dr. Speaks out on the CV HOAX

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

FataMorgana
2020-05-14, 07:58
#124

#122  

Och utan att ägna sig åt hårklyverier, hur skulle du svara då?

JRSN
2020-05-14, 08:15
#125

#124 Om du vidhåller att det finns entydiga fakta så har du gett dig in i en diskussion du omöjligen kan vinna. Dock är jag TOTALT ointresserad av att utveckla en sådan evighetsdiskussion. Tag en grundkurs i filosofi så förstår du bättre!

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

FataMorgana
2020-05-14, 08:33
#126

#125  

Vi talar inte om Kant och tingen i sig, utan om vår fysiska verklighet och hur den fungerar, där man mycket väl kan komma fram till entydig fakta. Det här handlar om fysik och inte om filosofi. Gå själv en grundkurs i fysik så förstår du bättre. För övrigt skriver jag inte för att tävla med någon om någonting. Det får stå för dig.

Huygens
2020-05-14, 09:29
#127

#126 Att skriva andra på näsan vad som ska göra, "gå grundkurs i fysik", är inte det att vara lite, hmm…

FataMorgana
2020-05-14, 14:13
#128

#127    

Och vem var det som skrev först vilka kurser en annan ska göra?

Condor
2020-05-14, 15:41
#129

#123

Den anonyma doktorn som predikar på gatan borde fara ner till Italien och jobba i ett sjukhus för att se hur det står till där.

Tinastarot
2020-05-15, 10:36
#130

Coronaviruset är på riktigt och den är här av en mycket större anledning än vad många kan tänka sig. Ur ett intuitivt och andligt perspektiv så är det Moder Jord som behöver rensa bort stress från planeten för att hela sig själv. Det finns en djupare mening till varför Corona är här som såklart inte media skriver om, utan media vill bara skrämma oss och vara rädda. Och med det skrivet så vill jag inte låta känslokall utan jag förstår att det är väldigt många därute som har det jobbigt just nu med sjukdom och/eller går igenom sorgarbete och jag sänder ut all min kärlek och styrka till er. 💕 🦋 Coronaviruset kommer även med ett djupare budskap till oss alla: att ifrågasätta våra liv som vi lever. Lever vi i kärlek eller lever vi i rädsla? Och vilka steg behöver vi ta för att komma i kontakt med vårat högre jag och livssyfte? 🦋 I ett ännu djupare budskap så finns det ingen död eller sjukdom. Det är bara en människo-sak som vi har hittat på. Om vi går runt och är rädda och ängsliga och tror på sjukdom så kommer vi bli sjuka. Men om vi lär känna vårt sanna jag, vårt andliga jag, så kan vi också hitta verktygen till att förstå våra tankar och energin runtom oss och arbeta med att transformera den negativa energin till det positiva, vilket leder till att du omöjligen kan bli sjuk. 🦋 🦋 🦋 💕

Min Själ Ärar Din Själ

JRSN
2020-05-15, 10:59
#131

#130 Hej Tina, bra skrivet! Det som kallas Corona, eller Covid-19, tror jag dock är en 'agenda' mer än ett faktiskt virus. Viruset har nämligen inte kunnat isoleras, vilket är märkligt (eller så har de inte orkat utan bara kört på med sin 'grej'). Men, och det är ett stort men, det finns dock ett antal jobbiga influensor i 'svang' därute och de är inte att leka med. Möjligen blir dessa också värre för personer som har vaccinerat sig under perioden 2013-2020. Sen har det ju också visat sig att rädsla och stress i sig är tillräckligt för att göra en sjuk, liksom negativa tankemönster.

Men precis som du säger så är det ingen slump att pandemin har kommit just i den här tiden. Vi ställs nu inför våra rädslor, av olika slag, och vi måste göra ett val. Ett val mellan rädsla och kärlek, där kärleken står för ett beslut att leva livet fullt ut och inte begränsa sig själv. Jag upplever att nya rön om människan och hennes förhållande till Universum kommer otroligt snabbt nu, det är faktiskt svårt att hänga med i svängarna. Troligen är det så att när människorna når upp till den 'kritiska massan' i att välja kärlek, då blir världen äntligen en bättre plats. 🌺

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-15, 11:46
#132

#131

JRSN, var har du fått det ifrån, att viruset inte har kunnat isoleras? Om jag googlar och kollar ser jag att viruset har isolerats i flera länder.

Viruset isolerades t.ex. :

i Ungern:  https://ungarnheute.hu/news/coronavirus-in-ungarn-isoliert-impfstoff-versuche-koennen-anfangen-60836/

i Italien: https://www.diepresse.com/5803901/coronavirus-in-tranen-einer-patientin-isoliert

i Kanada både isolerats och kultiverats: https://www.apotheke-adhoc.de/nachrichten/detail/pharmazie/kanadiern-gelingt-kultivierung-von-sars-cov-2-fortschritte-in-der-corona-forschung/

i Wuhan redan i December 2019: https://www.medmedia.at/im-fokus/corona/erste-sars-cov-2-genome-aus-oesterreich-sequenziert/

https://www.meduniwien.ac.at/web/ueber-uns/news/detailseite/2020/news-im-april-2020/erste-sars-cov-2-genome-aus-oesterreich-veroeffentlicht/

Det existerar redan flera olika vaccin, som genomgår en testfas. Utan att isolera viruset kan man inte utveckla/tillverka ett vaccin.

Huygens
2020-05-15, 12:21
#133

#132 Men var finns dom vetenskapliga rapporterna som visar hur forskarna gått till väga och vad dom fått för resultat? Dr Kaufman har påtalat att kanadensarna inte visat någon vetenskaplig rapport. Det finns ingenting annat än talade ord från en indisk forskare i Kanada. Det är din 3:e länk. Även på engelska: india.com, 2020-03-13

Det finns bara tidningsartiklar med påståenden. Inget bevisat virus. Bara hänvisning till twitter och till andra tidningsartiklar av allmän karaktär. Var finns den faktiska rapporten, som Dr Kaufman efterlyst.

Science by twitter är klent.

Din sista länk kommer med det märkliga påståendet: "Veränderungen im Vergleich zum Referenzgenom des Virus, das am 26. Dezember 2019 in Wuhan (China) isoliert wurde."

Verkligen? I Kina..?

Isolerat och renframställt före årskiftet 2019? Med fullständig RNA-sekvens..?

Dr Kaufman läste den kinesiska fejkrapporten och kunde helt döma ut den. Fanns inte tillstymmelse till bevis för något virus. Dr Kaufman har även gått igenom all forskning kring det första "SARS-viruset" från år 2002 och kommit fram till att inte heller det första "SARS-virset" blev någonsin isolerat och eller undersökt, trots att flera fejkvaccin togs fram, med döda laboratoriemöss som resultat.

Det enda du har att komma med är fejkrapporter och tidningspåståenden. Så fort Dr Kaufman tittat på "forskarrapporterna" har dom visat sej innehålla ingenting - dom har smulat sönder till damm.

Både "SARS-CoV-1" från år 2002 och "SARS-CoV-2" från år 2019 saknar bevis för existens, enligt Dr Kaufman. Jag föreslår att du spenderar en timme och lyssnar på vad Dr Kaufman säger, för han går igenom dom aktuella forskarrapporterna.

Att du kör runt i officiell medias lögner leder dej bara i cirkelresonemang. Du blir presenterad lögner, utan faktiska vetenskapliga studier eller ens riktiga forskarrapporter.

Men en sak ska du ha klar för dej.

Big Pharma är otroligt entusiastisk över att ha ett nytt fejkvirus efter AIDS-fejket. Det kommer finnas pengar att gödsla denna nya fantasin.

Condor
2020-05-15, 13:18
#134

#133

Du måste vara försiktig Hyugens, för du bryter mot följande sajtregler:

Skriv inte långa avhandlingar i kommentarer

- Användare som avkräver bevis av andra i olika frågor riskerar uteslutning och att inlägget omedelbart tas bort

Jag har ju inget problem med långa avhandlingar eller att ta fram studier eller och forskningsrapporter, men jag vill ju inte att du ska uteslutas när jag gärna diskuterar det här med dig.  Du skulle ju ha kunnat vänta med dina slutsatser om lögner tills du har fått ett svar av mig, bara för att inte göra bort dig.

Dr. Kaufmann kanske inte har kollat faktan ordentligt för det existerar ju fakta:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7045880/

https://www.ncbi.nlm.nih.gov/pubmed/32237278

https://www.tandfonline.com/doi/full/10.1080/22221751.2020.1760144

https://theconversation.com/i-study-viruses-how-our-team-isolated-the-new-coronavirus-to-fight-the-global-pandemic-133675

https://www.pnas.org/content/117/13/7001

https://www.oeaw.ac.at/detail/news/erste-sars-cov-2-genome-aus-oesterreich-veroeffentlicht/

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7067204/

Det finns många fler, så det är ju ganska skumt att Dr. Kaufmann inte hittar en enda. Det tror jag inte på och drar slutsatsen att Dr. Kaufmann är en lögnare.

Att du kör runt i enstaka doktorers  lögner leder dej bara i cirkelresonemang. Du blir presenterad lögner, utan att du ens gör dig mödan att kolla upp det som en skum okänd  doktor säger stämmer.  Du sväljer allt med hull och hår. Var har du den övertygelsen ifrån?

JRSN
2020-05-15, 13:51
#135

#134 SLUTA LARVA DIG MED REGELVERKET, CONDOR. JAG HANTERAR DETTA, INGEN ANNAN! 😡😈

Det finns givetvis fler läkare som ifrågasätter den officiella synen på Coronaviruset och på virus i allmänhet. Se videon nedan, starta ev. på 14.00.

Dr. Robert O. Young: What is a Virus

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-15, 14:31
#137

#135

Lite skoj får man väl göra 🙂

JRSN
2020-05-15, 14:33
#138

#137 Jätteskoj! 😛

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-15, 14:38
#139

#135

Det där verkar inte vara "Dr."  Youngs referensområde.  Han är inte ens doktor, utan han är "naturopathic practitioner and author of alternative medicine books promoting an alkaline diet""

https://en.wikipedia.org/wiki/Robert_O._Young

För mig är det en gåta varför folk gör sådana uttalande helt utan att kolla forskningen.  Varför ska man ifrågasätta hela forskningen bara för att några enstaka människor som inte kollar faktan utalar sig mot hela forskningen?

Condor
2020-05-15, 14:43
#140

#138

Du får förlåta, men i mitt land är det normalt och uppfattas inte som elakt att man skojar med varandra på det här viset, speciellt i Wien och område.  Det kallas "Wiener Schmäh"  https://de.wikipedia.org/wiki/Wiener_Schm%C3%A4h

och det som jag gjorde kallas att ta upp någon på spaden. Svenskarna kanske är lite mer stela och inte lika mottagliga för skoj.

JRSN
2020-05-15, 14:48
#141

#139 Du kan ju rimligtvis inte ens ha lyssnat på vad Robert O. Young säger. Kanske du skulle göra det först istället för att direkt ifrågasätta hans kompetens.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-15, 14:48
#142

Tillägg: till 139:

Ska betyda att han inte är doktor i medicin, utan i filosofi och "naturopathy"

Condor
2020-05-15, 14:51
#143

#141

Har du sett forskningen som jag refererade till i inlägg 134?  Varför ska jag ifrågasätta den, bara för enstaka människors personliga åsikter?

JRSN
2020-05-15, 14:51
#144

#140 Jaså, det kallas 'Wiener Schmäh' i Österrike, i Sverige kallas det trakasserier.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Condor
2020-05-15, 15:12
#145

#144

Olika kulturer, olika uppfattningar.  I mitt land tar man inte allt på så blodigt allvar som i norden och man vet att sådant inte är elakt menat, för det är ett tecken på en bra relation om man skojar med varandra.  En wiener kabaretist beskriver "Wiener Schmäh" som "grov-älskvärd och mestadels inte riktigt allvarlig form av samsyn".

Men jag förstår att man i norden inte förstår den sortens skoj. Ju längre norr som man reser, ju stelare och kallare blir folk. Ju längre söderut som man kommer, ju öppenhjärtligare blir folk.

JRSN
2020-05-15, 15:14
#146

#145 Ett kallt klimat har sina nackdelar.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

FataMorgana
2020-05-15, 15:15
#147

#135 

Jag har själv väldigt svårt för att lyssna på sådan här videon för att jag ofta har svårt att förstå vad som sägs och sen vill jag själv reflektera över innehållet, för att se om det stämmer eller för att googla omkring och leta reda på fakta och då  är det mycket enklare om jag har en text framför mig som jag nogrannt kan gå igenom. Så själv skulle jag uppskatta texter framför filmer.  

#144 😃

Ju längre tid jag bor i Österrike ju allvarsammare och humörlösare tycker jag att svenskarna bara blir. Så man kan inte alls skämta med svenskarna utan att det ska kallas för trakasserier nuförtiden. Nå då börjar jag förstå varför folk inte ser glimten i Condors öga  när han skriver sina inlägg.

Condor
2020-05-15, 15:26
#148

#146

Därför bor jag hellre längre söderut. "Wiener Schmäh" förstår inte ens tyskarna. Fast tyska är språket i båda länder, så talar Tyskar och Österrikare ändå olika språk. 

Jag hittade en beskrivning för "Wiener Schmäh" som jag översätter:

"Vissa älskar den, vissa hatar den.  Men hur som helst tar det en tid att vänja sig vid den. Wiener Schmäh beskriver den karakteristiska humorn hos wiener, som är mörk, själv ironisk, fin, men ofta också makaber. Även allvarliga frågor som döden behandlas med ett blink. Wiener Schmäh är en fin linje mellan humor och förolämpning och inte alltid korrekt förstått, särskilt för turister."

[Shamanens Ljus]
2020-05-15, 17:00
#149

#130 Mycket väl och bra skrivet, existensen Covid - 19  har vi i världen och det handlar om  hur vi förhåller oss till sjukdom och rädsla  i ett andligt perspektiv. Rädsla skapar sjukdom och även om vi skalat bort all rädsla så kan vi alla råka ut för sjukdom men är vi trygga med oss själva och andevärlden så behöver vi inte känna rädsla om vi drabbas.

Moder Jord som behöver rensa bort stress från planeten för att hela sig själv. Det finns en djupare mening till varför Corona är här som såklart inte media skriver om, utan media vill bara skrämma oss och vara rädda. 

Så är det, Modern måste försöka hämta igen sig för vi har redan orsakat henne sånt enormt  lidande genom alla tider och det är återkommande med olika katastrofer, sjukdomar med mer i en kamp från Modern att hela sig själv för hon är en levande varelse och  ande som vi.

Dock kommer hon som så många av oss att få släppa taget om planeten och vandra hem till ljuset där hon förenas med sin make Fader Gud, Moder jord är Gud Moder och Guds make vilka inom en ganska så kort tid måste förenas för att båda ska kunna fullfölja sina uppdrag.

Som du är inne på så kommer Corona med så mycket djupare budskap och insikter men människan är ännu inte redo för den insikten så det kommer att krävas flera tragedier, pandemier, naturkatastrofer innan Gud Moder får gå i vila och med sin make styra Universum i evig frid.

Mycket fint och insiktsfullt skrivet av dig Tinastarot 🌺   I ett ännu djupare budskap så finns det ingen död eller sjukdom. Det är bara en människo-sak som vi har hittat på. 

I grund och botten finns varken sjukdom eller död det har du alldeles rätt i även om vi drabbas här på jorden där vi befinner oss  på ett plan med en enormt trög energi och vibration som håller oss fast i det jordiska när vi istället behöver släppa det och bara känna den där underbara tilliten att allt blir som det ska och evigheten tar hand om oss och om allt. Många är rädda, uppskrämda av så oerhört mycket och under mina 35 år med shamanismen så har jag sett något vackert genom alla år och det är att jorden förändras medan andevärlden är och förblir den samma för där finns ingen nöd ingen klagan inga rädslor så dom behöver inte som oss känna rädslan och dom har inga förändringar där vandrar allt på i full glädje och frihet ❤️

-----

Till er andra i tråden så har jag läst  igenom den men har inte läst varenda ord exakt och noggrant för det är väldigt mycket text däremot kan jag se att ni talar olika språk  med olika ordval men är ändå inne på samma tankar i grund och botten och det är just språket och ordvalen som ofta gör det komplicerat att förstå varandra oavsett det är inom andligt eller världsligt.

När allt kommer omkring så har ni rätt allihop ur er egen erfarenhet det kan ingen ta ifrån er men att förstå varandra är inte alltid lätt på internet för vi uttrycker oss så olika men kikar man närmare så är där inte så stor skillnad det gäller att läsa och ta in innebörden i vad en annan människa uttrycker och står vi inför frågetecken så fråga era guider så förklarar dom det för er så väldigt enkelt är det och det är där tilliten ska finnas inte här på jorden för jorden är bara en illusion den behöver vi inte när vi väl nått hemmet och friheten .

Känn kärlek och optimism för det är vad Universum handlar om,  trygghet och befrielse inte rädsla för allt är gott om man börjar att granska sanningens kärleksbudskap  så är det stort   Hjärta

[Shamanens Ljus]
2020-05-16, 17:00
#150

Att viruset existerar det tror jag men det här är bra märkligt att ha testats åtta gånger och olika svar. Helt uppenbart är inte testen tillförlitliga  så då kan man ställa sig frågan hur många kan ha testats helt fel. Inte bra alls.

https://www.expressen.se/tv/nyheter/coronaviruset/han-har-testats-for-corona-atta-ganger-far-olika-svar/

Huygens
2020-05-16, 17:50
#151

#150 Nobelpristagaren (upptäckaren av PCR) profesor Kary Mullis har påpekat följande:

1. RT/PCR-testet som idag används som det enda sättet att ställa "coronadiagnos", det sk "coronavirustestet" för "COVID-19", får aldrig användas för att ställa diagnos.

PCR får aldrig användas för att ställa diagnos. (Mullis)

Och Dr Kaufman har påpekat:

2. RT/PCR-testet detekterar och tolkar RNA från exosomvesikler som "SARS-CoV-2-virus". Dvs vanligt mänskligt RNA blir felaktigt tolkats som att vara "coronaviruset".

Vilket leder till att fejkdiagnosen "COVID-19" ställs baserat på mänskligt genetiskt material och inte på virus-RNA, för det finns inget "nytt coronavirus från Wuhan" (inget SARS-CoV-2).

SARS-CoV-2 är fejk.

Likaså är SARS-CoV-1 också fejk.

Inga vetenskapliga studier existerar som isolerat viruset och hämtat ut RNA från dom två SARS-varianterna, enligt Dr Kaufmans genomgång av dom vetenskapliga rapporterna i ämnet. Se video i tidigare inlägg.

Däremot har Kinas diktaturregim, Big Pharma och USAs regim hysteriska mängder av makt och massövervakning att vinna på att allmänheten luras tro på existensen av "COVID-19".

Alla måste ju övervakas med mobilappar för att hindra "COVID-19".

Samtidigt med att allmänheten i USA satts i "frivillig" husarrest, rullas 5G ut på stor skala. När väl 5G börjar orsaka ARDS, och lungskador, är det en smal sak för Illuminati att skylla sjukdomssyndromen på "COVID-19". Speciellt som WHO stenhårt driver Bilderberggrupens agenda att man "troligen inte" kan bli immun mot fejksjukdomen "COVID-19".

Du är troligen inte immun mot fejksjukdomen "COVID-19", enligt WHO, även om du "tillfrisknat" från fejksjukdomen. (se ovan länkar)

FataMorgana
2020-05-16, 18:17
#152

#151 

Har du totalt missat att både Condor och jag har länkat till studier och forskning som visar att och hur viruset har isolerats och att jag till och med länkade  till en gendatabas?

JRSN
2020-06-04, 10:36
#153

Efter rekommendation från ledningen på 'ifokus' bör vetenskapligt inriktade resonemang undvikas på andliga och trosinriktade sajter som den här. Kommentarsfunktionen är därför avstängd i tråden.

……………………………………
Sajtvärd: Andar, Änglar & Demoner / Knackningsterapi
                      Hemsida: www.astromantra.se/

Inlägget är låst för nya kommentarer
Upp till toppen